KEGG   Hipposideros armiger (great roundleaf bat): 109373148
Entry
109373148         CDS       T04661                                 

Gene name
IL12A
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04620  Toll-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04940  Type I diabetes mellitus
hai05133  Pertussis
hai05134  Legionellosis
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05143  African trypanosomiasis
hai05144  Malaria
hai05145  Toxoplasmosis
hai05146  Amoebiasis
hai05152  Tuberculosis
hai05162  Measles
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05200  Pathways in cancer
hai05321  Inflammatory bowel disease
hai05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109373148 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109373148 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109373148 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    109373148 (IL12A)
   04625 C-type lectin receptor signaling pathway
    109373148 (IL12A)
   04658 Th1 and Th2 cell differentiation
    109373148 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109373148 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109373148 (IL12A)
   05330 Allograft rejection
    109373148 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109373148 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109373148 (IL12A)
   05134 Legionellosis
    109373148 (IL12A)
   05152 Tuberculosis
    109373148 (IL12A)
  09172 Infectious disease: viral
   05162 Measles
    109373148 (IL12A)
   05164 Influenza A
    109373148 (IL12A)
   05168 Herpes simplex virus 1 infection
    109373148 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109373148 (IL12A)
   05144 Malaria
    109373148 (IL12A)
   05145 Toxoplasmosis
    109373148 (IL12A)
   05140 Leishmaniasis
    109373148 (IL12A)
   05142 Chagas disease
    109373148 (IL12A)
   05143 African trypanosomiasis
    109373148 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109373148 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109373148 (IL12A)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interleukins
   109373148 (IL12A)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Cytokines
   109373148 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 109373148
NCBI-ProteinID: XP_019482353
LinkDB
Position
Un
AA seq 241 aa
MXPPGSASXTPSPAASSHPRPVSGSVSAQCPLSMRPPRSLLLVATLVLLNHLDHLSLARS
LPTATPGPGMFQCLYLSQNLLKAVSNMLQKASQTLEFYSCTSEEIDHEDITKDKTSTVEA
CLPLELTTNGSCLASRKASSVTTLCLSSIYEDLKMYQVEFQAINAKLLMDPKRQIILDQN
MLAVIDELMQALNFNSETVPQKPSLEELDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNS
S
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtgaccccctgggtcggcctcctaaacgccctcacctgctgcatccagccatccgcgt
ccagtttctggctcagtgtctgcgcagtgccccctcagcatgcgcccgccgcgcagcctt
ctcctggtggccaccctggtcctgctaaaccacctggaccacctcagtttggccaggagc
ctccccacagccacaccaggcccaggaatgttccagtgcctctacctctcccaaaacctg
ctgaaggcagtcagcaacatgcttcagaaggccagccaaactctagaattttactcctgt
acctctgaagagatcgatcatgaagatatcacaaaagataaaaccagtacagtagaggcc
tgcttaccactggaattaaccacgaatgggagttgcctggcttccagaaaggcctcttct
gtgacgaccctgtgccttagtagtatctatgaggacttgaagatgtaccaggtggagttc
caggccataaatgcaaagcttttgatggatcctaagaggcagatcattttggatcaaaac
atgctggcagttattgatgagctaatgcaggccttgaatttcaacagcgagactgtgcca
caaaaaccctcccttgaagagctggatttttataagacgaaaatcaagctctgcatcctt
cttcatgctttcagaattcgtgcagtaactatcgataggatgatgagctacctgaattct
tcctaa

KEGG   Hipposideros armiger (great roundleaf bat): 109388897
Entry
109388897         CDS       T04661                                 

Gene name
IL12B
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04620  Toll-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04940  Type I diabetes mellitus
hai05133  Pertussis
hai05134  Legionellosis
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05143  African trypanosomiasis
hai05145  Toxoplasmosis
hai05146  Amoebiasis
hai05152  Tuberculosis
hai05162  Measles
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05321  Inflammatory bowel disease
hai05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109388897 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109388897 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109388897 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    109388897 (IL12B)
   04625 C-type lectin receptor signaling pathway
    109388897 (IL12B)
   04658 Th1 and Th2 cell differentiation
    109388897 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109388897 (IL12B)
   05205 Proteoglycans in cancer
    109388897 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109388897 (IL12B)
   05330 Allograft rejection
    109388897 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109388897 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109388897 (IL12B)
   05134 Legionellosis
    109388897 (IL12B)
   05152 Tuberculosis
    109388897 (IL12B)
  09172 Infectious disease: viral
   05162 Measles
    109388897 (IL12B)
   05164 Influenza A
    109388897 (IL12B)
   05168 Herpes simplex virus 1 infection
    109388897 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109388897 (IL12B)
   05145 Toxoplasmosis
    109388897 (IL12B)
   05140 Leishmaniasis
    109388897 (IL12B)
   05142 Chagas disease
    109388897 (IL12B)
   05143 African trypanosomiasis
    109388897 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109388897 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109388897 (IL12B)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interleukins
   109388897 (IL12B)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Cytokines
   109388897 (IL12B)
SSDB
Motif
Pfam: IL12p40_C fn3 Ig_4 Ig_5 Ig_3 I-set Ig_2
Other DBs
NCBI-GeneID: 109388897
NCBI-ProteinID: XP_019509514
LinkDB
Position
Un
AA seq 328 aa
MLQQWLVLSCFSLVFLASPLVAKWELEKDVYVVELDWYPDAPGEKVDLACNTLEEDGITW
TSDQSSEVLGSGKTLTIQVREFGDAGQYTCHRGGEVLSRSLLLLHKKEDEIWSTDILKDQ
KESKTKTFLKCEAKNYSGHFTCWWLTAISTDLKFSVKSSRGASDPRGVTCGAVTLSAERV
TVDQREYKKYTVECQEGSACPAAEESLPIEVVLDAIHKLKYENYTSSFFIRDIIKPDPPK
NLQLKPLRNSRQVEVSWEYPDTWSTPHSYFSLTFSLQIQGSKREKKDRPFVDKTSAKVTC
PKDAVIRVQARDRYYSSSWSEWASVPCS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgcttcagcagtggttggtcctctcctgtttttccctggtttttctggcatcgcccctc
gtggccaaatgggaactggagaaagatgtttatgttgtagagttggattggtaccctgat
gcccctggagaaaaggtggacctcgcctgcaatacccttgaagaagacggcatcacctgg
acctcggaccaaagcagtgaggtcttaggctctggcaaaaccttgaccatccaagtcagg
gagttcggagatgctggccagtacacctgtcacagaggaggcgaggttctgagccgttct
ctcctgctgctgcacaaaaaggaagacgagatttggtccactgatattttaaaggaccag
aaagaatccaaaactaagacctttctaaaatgtgaggccaagaattattccggtcatttt
acctgctggtggctgacggcaatcagtacggatttgaaattcagcgtcaaaagcagcaga
ggcgcctcggacccccgaggggtgacgtgcggagcagtgacactctcagcagagagggtc
acagtggaccagagggagtacaagaaatacacagtggagtgccaggagggcagtgcgtgc
ccagccgcggaggagagcctgcccattgaggttgtgctagatgctattcacaagctcaag
tatgaaaactacaccagcagcttcttcatcagagacatcatcaaacccgacccgcccaag
aacctgcagttgaagccattaaggaattcccggcaggtggaggtcagctgggagtacccc
gacacctggagcactccacattcctacttctccttgacgttttctcttcagatccaaggc
agcaagagagaaaagaaagatagacccttcgtggacaagacctcagccaaggtcacgtgc
cccaaggatgccgtgatccgcgtgcaagcccgggaccgttactacagctcctcctggagc
gaatgggcatcggtgccctgcagttag

DBGET integrated database retrieval system