KEGG   Hipposideros armiger (great roundleaf bat): 109373168
Entry
109373168         CDS       T04661                                 

Gene name
CCL5
Definition
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04061  Viral protein interaction with cytokine and cytokine receptor
hai04062  Chemokine signaling pathway
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04668  TNF signaling pathway
hai05020  Prion disease
hai05142  Chagas disease
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109373168 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109373168 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109373168 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109373168 (CCL5)
   04621 NOD-like receptor signaling pathway
    109373168 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    109373168 (CCL5)
   04062 Chemokine signaling pathway
    109373168 (CCL5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109373168 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    109373168 (CCL5)
  09172 Infectious disease: viral
   05164 Influenza A
    109373168 (CCL5)
   05168 Herpes simplex virus 1 infection
    109373168 (CCL5)
   05163 Human cytomegalovirus infection
    109373168 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109373168 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109373168 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109373168 (CCL5)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Chemokines
   109373168 (CCL5)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Chemokines
   109373168 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 109373168
NCBI-ProteinID: XP_019482396
LinkDB
Position
Un
AA seq 91 aa
MKVSAAALAVLLAAAAFCAPASASPYASDTTPCCFGYISRPLPHTHIQEYFYTSSKCSMP
AVVFITRKKRQVCANPEKKWVREYINSFELN
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcagctgccctagctgttctccttgccgctgctgccttctgcgctcct
gcatctgcctccccatatgcctcggacaccactccctgctgttttggctacatctcccgt
ccactgccccacacccacatccaggagtatttctacaccagcagcaagtgctccatgcca
gcagtcgtctttatcacccgaaaaaaacgccaggtgtgtgccaacccagagaagaaatgg
gtgcgggagtacatcaactcttttgagttgaactag

DBGET integrated database retrieval system