KEGG   Hipposideros armiger (great roundleaf bat): 109373230
Entry
109373230         CDS       T04661                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04066  HIF-1 signaling pathway
hai04217  Necroptosis
hai04380  Osteoclast differentiation
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05200  Pathways in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109373230 (IFNGR2)
   04066 HIF-1 signaling pathway
    109373230 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109373230 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109373230 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109373230 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    109373230 (IFNGR2)
   04659 Th17 cell differentiation
    109373230 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109373230 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109373230 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109373230 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109373230 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109373230 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    109373230 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    109373230 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109373230 (IFNGR2)
   05140 Leishmaniasis
    109373230 (IFNGR2)
   05142 Chagas disease
    109373230 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hai04050]
    109373230 (IFNGR2)
Cytokine receptors [BR:hai04050]
 Interleukin receptor families
  IFN receptor family
   109373230 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 109373230
NCBI-ProteinID: XP_019482492
LinkDB
Position
Un
AA seq 360 aa
NVGISRFPLHCLSPLPPKAPLLPLPRPFLPRPFKPVFQKELKAACVLQRLFRKPKFKLHD
SVSQLPAPQNVKIHLYNTKQVLSWDAVSLGNDTRPVVYQVQFKHSRNEWLNVIKDVNCSR
ITLTVCNFTPTSHLKGFPLYFNVSLRVRAELEDRVSDWVTVPWFQHYLNATIGPPENIQV
TPGDRSLIIRLSPPFEVNAPKATFSYYVHYWEREGIKQVKGPFKRNTIVLKDLKPLREYC
LQVKAELSGTELNLSRLGRLSNETCHETTVDASPKPEQIILIAVGTFLLLSVLAGGCLFL
VLKYRSLIKYWFQSPPNIPLQIEEYLKDPAQPILEALDKDSSPKDDAWDCVSIISFPEKE
NT seq 1083 nt   +upstreamnt  +downstreamnt
aatgtgggcatttcccgtttccctctgcattgtctgtccccattaccccccaaagcccca
ctcctccctttacctaggccctttctacctcgacccttcaaacctgttttccaaaaagag
ttaaaagctgcctgtgtgcttcagaggcttttcagaaagcccaagtttaaactacatgac
tctgtttcccagctgcctgcacctcaaaacgtgaagattcacctgtacaataccaagcag
gttctgagttgggacgcggtgtccctgggcaatgacacgaggccagtggtctaccaggtg
cagttcaaacactcccgtaatgagtggttgaacgtcatcaaagatgtgaattgttcgagg
atcaccttgacagtgtgtaacttcaccccaaccagccacttgaagggtttcccactatat
ttcaacgtctctttacgtgtccgagctgaactggaagatcgcgtttctgactgggtgaca
gtgccttggttccaacactatctgaatgctaccatcgggcctccagaaaacatccaggtg
accccaggagacagatcccttatcatcaggctctcccctccctttgaagtcaatgccccc
aaggccactttttcatactatgtccattactgggaaagggaaggaatcaaacaggttaaa
ggccctttcaaaaggaacaccattgtgttgaaggatttaaaacccttaagagaatactgt
ttacaagtcaaggcagaactgtctgggacagagctaaatctctctagacttgggcgttta
agcaacgaaacttgtcacgaaacgacagtagatgcctcccccaagcctgaacaaatcatc
ttgattgctgtgggaacctttttgttgctgtcagtgctggctgggggctgtctcttcctg
gtcctgaaatacagaagcctgattaaatactggtttcagtctccaccaaacatcccatta
caaatagaagagtatttaaaggacccggctcagcctattttagaggctttggacaaggac
agctcgccaaaggatgatgcctgggactgtgtgtccatcatttcatttccggagaaggag
tga

KEGG   Hipposideros armiger (great roundleaf bat): 109376141
Entry
109376141         CDS       T04661                                 

Definition
(RefSeq) interferon gamma receptor 1-like
  KO
K05132  interferon gamma receptor 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04066  HIF-1 signaling pathway
hai04217  Necroptosis
hai04380  Osteoclast differentiation
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05164  Influenza A
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05200  Pathways in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109376141
   04066 HIF-1 signaling pathway
    109376141
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109376141
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109376141
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109376141
   04658 Th1 and Th2 cell differentiation
    109376141
   04659 Th17 cell differentiation
    109376141
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109376141
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109376141
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109376141
  09163 Immune disease
   05321 Inflammatory bowel disease
    109376141
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109376141
  09172 Infectious disease: viral
   05164 Influenza A
    109376141
   05168 Herpes simplex virus 1 infection
    109376141
   05167 Kaposi sarcoma-associated herpesvirus infection
    109376141
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109376141
   05140 Leishmaniasis
    109376141
   05142 Chagas disease
    109376141
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hai04050]
    109376141
   04090 CD molecules [BR:hai04090]
    109376141
Cytokine receptors [BR:hai04050]
 Interleukin receptor families
  IFN receptor family
   109376141
CD molecules [BR:hai04090]
 Proteins
  109376141
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind EphA2_TM
Other DBs
NCBI-GeneID: 109376141
NCBI-ProteinID: XP_019487452
LinkDB
Position
Un
AA seq 469 aa
MAFLLLVLIMQVVSRAEISAADPELGSVVVQVPVPTNIKIEAYNLNSDILWDYPEMLETP
VFTVXVKTYGKGLWINACNTSHYNCNIFSMTDDLSSGLWSRVKDRLGQEEYAYVESKEFI
LCREGKVGPPNLDVRQEENQIIIDIFHPLVVVDGKELAAIYDEENTCYSFIYKXYERISG
SETTHTHNTNQEDDCNETHCHLSISVSSLNAEHCITADGFSERWHVTTEKSKEVCITTRS
HESIADSVWIPAGATILIFVVFSLVVLCCNIKNMNSCKKENIMLPKSLLSVVKNSSSKAK
SESKYVSPATYEAIVPENEKVVWEELLSPATISSTHTEDNPAKVEDRSSETEVVTIEENT
SDMVPGSPLTPAIREDYVHSSSNQSEPGSVALNSYHSRIGSHSGLQESDSLSDSEFPPNT
STEIKTGGQESGLLRNATTSFGYDKPHVLVDLLVDEGGYRATADSKEFS
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggctttcctcctcctcgtcctcatcatgcaggttgtgagcagggctgagatcagcgcc
gcggatccggagcttggaagtgtggtagtgcaagtgcctgtaccaaccaatattaaaatt
gaggcctataacttgaattctgacatactttgggattacccagaaatgctagagacacct
gtttttactgtataggtaaagacatacgggaagggactatggattaatgcctgcaatacc
tctcattataattgtaatatattttccatgactgatgatctttcaagtggtctatggtcc
agagttaaagataggcttggacaggaagaatatgcctatgtagagtcaaaagaatttatt
ttgtgcagagaagggaaagttggaccacctaacctggatgtcagacaggaggaaaaccaa
atcattattgatatatttcatcctttagttgttgtagatggaaaagagctggcagccata
tatgatgaagaaaatacttgttattcattcatatacaagntgtatgagagaataagtgga
agtgagaccacacacacacataacacaaatcaggaagatgattgcaacgagactcattgc
cacctaagtatttcagtgtcctcactgaatgctgagcactgtattacagcagacgggttc
tcagagagatggcacgttacaactgaaaaatccaaagaagtctgtattaccactcgcagt
catgagagcattgcagattctgtttggattccagctggtgccactatcctaatctttgta
gtatttagcctggtagttctatgttgtaacattaagaatatgaattcatgtaagaaagaa
aacatcatgttacccaagtcattgctgtctgttgtaaaaaattcctcttcaaaggcaaaa
tcggaatcaaaatatgtatcacctgccacgtatgaagcaattgtccctgaaaatgagaag
gtggtctgggaagagctgttgtcaccagcaaccatttcaagtacgcatactgaggacaat
ccagcaaaagtagaagacagatctagtgaaacagaagtggtgaccattgaagaaaatact
tctgacatggtccctggcagccccctgactccagccatcagagaggattatgtccactca
agtagtaaccagtctgaacccggcagcgttgctctaaactcttatcactccagaattggt
tctcatagtggccttcaagaatcggacagcttatctgactcagaatttcctccaaatact
agcactgaaataaagacaggaggacaggaatctggcctgctgagaaatgctaccacctcc
tttgggtatgataaaccacacgtgttagtggatctgctcgtggacgaaggtggttacaga
gccacagctgattccaaagagttttcataa

KEGG   Hipposideros armiger (great roundleaf bat): 109385640
Entry
109385640         CDS       T04661                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04066  HIF-1 signaling pathway
hai04217  Necroptosis
hai04380  Osteoclast differentiation
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05164  Influenza A
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05200  Pathways in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109385640 (IFNGR1)
   04066 HIF-1 signaling pathway
    109385640 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109385640 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109385640 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109385640 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    109385640 (IFNGR1)
   04659 Th17 cell differentiation
    109385640 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109385640 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385640 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109385640 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109385640 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109385640 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    109385640 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    109385640 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109385640 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109385640 (IFNGR1)
   05140 Leishmaniasis
    109385640 (IFNGR1)
   05142 Chagas disease
    109385640 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hai04050]
    109385640 (IFNGR1)
   04090 CD molecules [BR:hai04090]
    109385640 (IFNGR1)
Cytokine receptors [BR:hai04050]
 Interleukin receptor families
  IFN receptor family
   109385640 (IFNGR1)
CD molecules [BR:hai04090]
 Proteins
  109385640 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind EphA2_TM
Other DBs
NCBI-GeneID: 109385640
NCBI-ProteinID: XP_019503675
LinkDB
Position
Un
AA seq 462 aa
MAFLLLVLVMQVVSRAEISAADPELSSVPVPTNIKIEAYNLNSDVRWDYPEMLEIPVFTV
QVKTYGKGLWIDACNTSHHSCNIFSMTDDPSSGLWARVKARLGQEESAYAESKEFILCKD
GKVGPPNLEVRQKEDQIIIDIFHPSVVIDGQELGTIYDEENTCYLFMYRVYERISGSEIT
RTHTINQEDDCNETKCHLSILVSSLNAEHCITADGFSERWHVTTKKSKEVCITTHSHESN
TDSVWIPVGTACLLFVVVSLVVLCCNMKKMNSCKKENIMLPKSLLSVVKNSSSEAKLESK
YVSPITYEAIVSENEKKVIWEEQLSPATISSTHTEDNPAKVEDRDLSSETEVVTIEENTS
DMVPGSPLTPAVKEDCVHSSSNQSEPSSVALNSYHSRNGSDSGLQESDSSSDSGGQESGL
LRNATTSFGYDKPHVLVDLLVDEGGKESLIGYRVTADSKELS
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggctttcctcctcctcgtcctcgtcatgcaggttgtgagcagggctgagatcagcgcc
gcggatccggagctgtcctcggtgcctgtaccaaccaatattaaaattgaggcctataac
ttgaattctgacgtacgttgggattacccggaaatgctagagatacctgtttttactgta
caggtaaagacatacgggaagggactatggattgatgcctgcaatacttctcatcatagt
tgtaatatcttttccatgactgatgatccatcaagtggtctatgggccagagttaaagct
aggcttggacaggaagaatcggcctatgcagagtcaaaagaatttattttgtgcaaagac
gggaaagttggaccacctaacctggaagtcagacagaaggaagaccaaatcattattgat
atatttcatccttcagttgttatagatggacaagagctgggaaccatatatgatgaagag
aatacttgttatttattcatgtacagagtgtatgagagaataagtggaagtgagatcaca
cgtacacataccataaatcaggaagatgattgcaacgagactaagtgccacctaagtatt
ttagtgtcctcactgaatgctgagcactgtattacagcagacgggttctcagagagatgg
catgttacaactaaaaaatccaaagaagtctgtattaccactcacagtcatgagagcaat
acagattctgtttggattccagttggtaccgcttgcctactctttgtagtagttagcctg
gtagttttatgttgtaacatgaagaagatgaattcatgtaagaaagaaaacatcatgtta
cccaagtcattgctgtctgttgtaaaaaattcctcttcagaggcaaaattggaatcaaaa
tatgtatcacccatcacctatgaagcaattgtctctgaaaatgagaagaaggtgatctgg
gaagagcagttgtcgccagcaacaatttcaagtacgcatactgaggacaatccagcaaaa
gtagaagacagagatctttctagtgaaacagaagtggtgaccattgaagaaaatacttct
gacatggtccctggcagccccctgactccagccgtcaaagaggattgtgtccactcaagt
agtaaccagtctgaacccagcagcgttgctctaaattcttatcactccagaaatggttct
gatagtggccttcaagaatcggacagctcatctgactcaggaggacaggagtctggcctg
ctgagaaatgctaccacctcctttgggtatgataaaccacacgtgttagtggatctgctc
gtggacgaaggtggtaaggagtccttgattggttatagagtcacagccgattccaaagag
ctttcataa

DBGET integrated database retrieval system