KEGG   Hipposideros armiger (great roundleaf bat): 109373231
Entry
109373231         CDS       T04661                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04151  PI3K-Akt signaling pathway
hai04217  Necroptosis
hai04380  Osteoclast differentiation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109373231 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    109373231 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109373231 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109373231 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109373231 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    109373231 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    109373231 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109373231 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109373231 (IFNAR1)
  09172 Infectious disease: viral
   05162 Measles
    109373231 (IFNAR1)
   05164 Influenza A
    109373231 (IFNAR1)
   05161 Hepatitis B
    109373231 (IFNAR1)
   05160 Hepatitis C
    109373231 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    109373231 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109373231 (IFNAR1)
   05169 Epstein-Barr virus infection
    109373231 (IFNAR1)
   05165 Human papillomavirus infection
    109373231 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hai04050]
    109373231 (IFNAR1)
Cytokine receptors [BR:hai04050]
 Interleukin receptor families
  IFN receptor family
   109373231 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 109373231
NCBI-ProteinID: XP_019482493
LinkDB
Position
Un
AA seq 685 aa
MWQNINNLVNLGKAYAGVLYFCNFSPPQYQGPRVRDQGEEGRRPRAPDGALLQPSAGRGK
GIPELRDPRRSTGNAPRPCEDQRLQLGAIFREGTGGSRVGGLRPENCGATNRQGGLTLSQ
ERTRACALLFSPPPGATHVARGAGAGRARKGRGERGGWGLARGVPCAHRLPAGCSRTALV
AWDVTGRVCGGPRTMFAHLGVTTLVLVAGAPWVLPSAAGERRGVPAQASGRGARLGGGDV
GSHGLGRWLGGKRCPSGRPLVIPGRSAQIETDLGSNSKQEEVVFKILGTPLDWRPAYPSP
DWGRPPLPSSALGRSLVTQPSGTGCARAFVVTSTKCNFTSPDINVYEEMKLRIRAEKGNS
TSPWYEVAPFIPFQQAQIGPPEVHLQAEDKAIMIDISPPGTEHSIMWVLESSSFSYSLVI
WKNSSGGENRTETIHSKDKIYNLSPETTYCLKVKTRLRRQRKIASYSPVQCITTTVENKL
PPPENVQMVAKNQTYVLKWDYTYENMTFQAQWLHAHFKKMSEDYSGKWKQIQNCENVRIT
QCVFPQNVFPNGIYYIRVQASDGNSTSFWSKEEKFDIDIQTLILPPVINLKPINNSLRVY
IGTPKASQNKPVYPHYLLIYEITFWENTSNAERKIVKKRTDFTFPDLKPLTVYCVKVRAL
LDDEKRDKSSVFSDTVCEKTKPGLF
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgtggcaaaatattaacaatttggtgaatctgggaaaagcgtatgcaggagttctctat
ttttgcaacttttccccgccccaataccaaggcccccgagttcgcgaccagggggaggaa
gggcgaaggcctagagcgcctgacggtgcgctcctgcagccatcagcgggaagggggaaa
gggattcctgagctgagagatccgcgcaggagcacaggcaacgcgccacgtccctgcgag
gatcaaaggctccagttaggcgctatcttccgagaaggcacgggaggatcccgagtgggc
ggtctcaggccggaaaactgcggcgccacgaacaggcagggcggcctaacactttcccag
gagcgaactcgggcgtgcgctctactgttctccccccccccaggagcaacccacgttgcc
agaggcgcgggggcggggcgtgcgcggaaggggcggggcgagcgcggtgggtggggactg
gcccggggcgttccctgtgcacacaggcttcccgcgggctgctcccgcactgcgctggtg
gcctgggatgtgaccggccgggtctgcggcggcccgaggacaatgtttgcccacctgggc
gtgacgaccctagtgctggtcgccggggctccatgggtcttgccctcggctgcaggtgag
agacgaggggtcccggcgcaggcttcggggcgcggcgcgaggctgggcgggggcgatgtt
ggaagccacggtctggggaggtggctgggtggtaaaagatgtccttccgggaggcccctg
gtcatccctggccgcagtgctcagattgaaaccgacttgggctcgaatagcaagcaagag
gaagtagtgttcaagatcttaggcacgccgcttgattggcggccagcgtacccctccccg
gactgggggcgccctcccctcccgtcctccgccctcggccgcagcctcgtcactcagccc
agcggcactggatgtgcgagagccttcgtngttactagtaccaaatgcaactttacttca
cctgacataaatgtttatgaagaaatgaaactgcgtataagagcagaaaagggaaacagc
acttctccatggtatgaggttgccccgtttataccatttcaacaagcccaaattggtcct
ccagaagtacatttacaagctgaagataaggcaataatgatagacatctctcctcctggg
acagaacatagtatcatgtgggtcctggaaagttccagctttagctacagcttagtaatc
tggaaaaattcttcaggtggagaaaacaggactgaaaccattcattccaaagataaaatt
tataacctctcaccagagactacttactgtttaaaagttaaaacaagactacgacggcag
agaaaaattgcttcgtatagtccagtgcaatgtataactaccacagttgaaaataaactg
cctccgccggaaaatgtacaaatggttgctaaaaatcagacctatgttcttaaatgggat
tacacatatgaaaacatgacttttcaagctcagtggctccatgcccattttaaaaagatg
tctgaggactattcaggaaaatggaaacaaatacaaaactgtgagaatgtcagaatcacc
cagtgtgtctttcctcaaaatgttttcccaaatggaatttactatatccgtgtacaagcg
tccgatggaaatagcacatctttttggtccaaagaggaaaaatttgatattgacatacaa
actctcatacttcctccagtcattaatctgaagcccattaataactcactgcgtgtctat
atcggtactccaaaagcctctcaaaacaagccagtgtacccgcattacctgctcatttat
gaaattactttttgggaaaacacttcaaatgctgagaggaaaattgtaaagaaaagaact
gattttactttccctgacttgaaaccgctaactgtatattgtgtcaaagtcagagcactc
cttgatgatgaaaagcgggataaaagcagtgtttttagtgatactgtatgcgagaaaaca
aaaccaggcctcttttaa

KEGG   Hipposideros armiger (great roundleaf bat): 109373246
Entry
109373246         CDS       T04661                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha and beta receptor subunit 2
  KO
K05131  interferon receptor 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04151  PI3K-Akt signaling pathway
hai04217  Necroptosis
hai04380  Osteoclast differentiation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai05160  Hepatitis C
hai05162  Measles
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109373246 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    109373246 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109373246 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109373246 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109373246 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    109373246 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    109373246 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109373246 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109373246 (IFNAR2)
  09172 Infectious disease: viral
   05162 Measles
    109373246 (IFNAR2)
   05164 Influenza A
    109373246 (IFNAR2)
   05160 Hepatitis C
    109373246 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    109373246 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109373246 (IFNAR2)
   05169 Epstein-Barr virus infection
    109373246 (IFNAR2)
   05165 Human papillomavirus infection
    109373246 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hai04050]
    109373246 (IFNAR2)
Cytokine receptors [BR:hai04050]
 Interleukin receptor families
  IFN receptor family
   109373246 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind Uroplakin_II
Other DBs
NCBI-GeneID: 109373246
NCBI-ProteinID: XP_019482506
LinkDB
Position
Un
AA seq 519 aa
MLLSQNASAMRTHNLYLMVYISLMFGVFQALPDFSQDACIFKMTLRNFRVILSWELKNHS
IVPTHYTLWYTIMSKQDDMKAVKDCANITGSFCDLTDVWENMSENYIPRLVGSRGNATLV
NCSGSIFPPLNMSLEPPNFEIIRFTDHIKVRVKFPPDIPKILRGEELHFYLSLVIEEESG
EIVKKHKLQMNAKTITENFTYVIDNLIPNTSYCVSVYFEPTDLGKTMKSPPKCTLLPPGE
ESESSDSAKIGGLVTTFLIVAVFVSTIILLRQIGCICLTNKLPKVLNFYNFSAWVFPERP
PLEAAAVLEVIHVNRKKKVWDYNYDDDESDSDNEAAPRTSAGGYTMHGLTGRPLCPASAS
SATLEDCSNLDAEETDVPEAEAESESLMAPGPGPWQPECTSEAYKGRGTLLEEPFSEEDS
SSMEGSEDRIIFNVDLNSVCVRVFSDDLEAPPVLSLPEDNTQLQDPNEMETNLLVASGGG
TQPSFPGPSVECLWPEDSLSEKSDTSESDVNIGDGYIMR
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgcttttgagccagaatgcctcggcaatgagaacacataatttgtatctcatggtgtac
atcagcctcatgtttggtgttttccaagctttgcctgatttttcacaggatgcttgcatt
ttcaagatgacattaagaaatttccgggtaattttatcatgggaattaaaaaatcattcc
attgtaccaactcactatacattgtggtacacaatcatgagtaaacaagatgatatgaag
gctgttaaggactgtgcaaatatcacgggatcattttgtgacctaacagatgtgtgggaa
aacatgtccgagaattacatccccagactcgttgggtcccgagggaacgcaacgctggtc
aattgctcgggctccatcttcccaccgctgaacatgtctttggaaccaccaaactttgag
attattcgttttactgaccacattaaagtgagagtgaaatttccgcccgacatacccaag
atactacgtggggaagaattacatttttacttatcacttgtcatcgaagaagagtcagga
gaaattgttaagaagcataaactgcaaatgaatgcaaaaaccatcactgaaaatttcact
tacgtcatcgacaacttaattccaaacacaagctactgtgtatctgtttatttcgagcct
accgatctgggaaaaacaatgaaatctcccccaaaatgtaccctccttccacctggagag
gaatcagagtcatcagattctgccaaaataggaggattggttactacgtttttgatagta
gctgtcttcgtaagcaccataatactactgcgacagattggttgtatatgcttaacaaat
aagctccccaaagtgctgaatttttataacttttcagcctgggtatttcccgagcggccg
ccattggaagcagcggctgtgttggaggtcattcacgtcaacagaaagaagaaagtgtgg
gattataattatgatgatgatgaaagtgacagcgataatgaagcagccccccgaacaagc
gcggggggttacaccatgcacggactaactggcaggcctctgtgtccggcctctgcctcc
tcagccaccttggaggactgcagcaacctagacgctgaggaaaccgacgtgcccgaggcc
gaggctgaatcggagtctctgatggcaccagggcctggcccctggcagccggaatgcact
agtgaggcctacaaggggagagggactctgctggaagagcccttttctgaggaggacagc
agctccatggagggttctgaagacagaattatcttcaatgtggatttaaactctgtgtgt
gtgagggtcttcagtgacgacttagaagcccctccagtgttatctcttccagaagataac
acccaattacaggatcccaacgaaatggaaacaaaccttttggtggccagtggaggaggg
acacagccgtccttccctggcccctctgtggagtgcctgtggcctgaagattccctttcc
gaaaaaagtgacacttctgagtcagatgttaacatcggggatggttatataatgagatga

DBGET integrated database retrieval system