KEGG   Hipposideros armiger (great roundleaf bat): 109373303
Entry
109373303         CDS       T04661                                 

Gene name
BID
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01524  Platinum drug resistance
hai04071  Sphingolipid signaling pathway
hai04115  p53 signaling pathway
hai04210  Apoptosis
hai04215  Apoptosis - multiple species
hai04217  Necroptosis
hai04650  Natural killer cell mediated cytotoxicity
hai04932  Non-alcoholic fatty liver disease
hai05010  Alzheimer disease
hai05014  Amyotrophic lateral sclerosis
hai05022  Pathways of neurodegeneration - multiple diseases
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    109373303 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109373303 (BID)
   04215 Apoptosis - multiple species
    109373303 (BID)
   04217 Necroptosis
    109373303 (BID)
   04115 p53 signaling pathway
    109373303 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109373303 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109373303 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109373303 (BID)
   05014 Amyotrophic lateral sclerosis
    109373303 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    109373303 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109373303 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109373303 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109373303 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109373303 (BID)
   05162 Measles
    109373303 (BID)
   05164 Influenza A
    109373303 (BID)
   05161 Hepatitis B
    109373303 (BID)
   05160 Hepatitis C
    109373303 (BID)
   05168 Herpes simplex virus 1 infection
    109373303 (BID)
   05163 Human cytomegalovirus infection
    109373303 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109373303 (BID)
   05169 Epstein-Barr virus infection
    109373303 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109373303 (BID)
SSDB
Motif
Pfam: BID PADR1 Bcl-2 CRM1_C
Other DBs
NCBI-GeneID: 109373303
NCBI-ProteinID: XP_019482605
LinkDB
Position
Un
AA seq 222 aa
MSSDICRLLPWTPVSQKPVKLPAVCAMDPQVSNGSGLQDEHITDLLVFGFLQNCSICNFH
KELKVLGHDLPVPTYLREGPDDELQTDGNLYSHFVLEGRRTDSESQEEIIQNIARQLAQI
GDTMECRIPPTLVNRLAEQFMNGDLSEEDRRRCLATALDQLMQTFPKDMEKEKAMLMLTL
LLAKKVADHMPSLLQDVFRTTVNFINQNLLTYVRNLFRNEMD
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtcttcagacatttgcaggctgctgccgtggacacctgtgagccagaagccagtcaag
ctgccagctgtctgtgccatggatccccaggtcagcaatggttcaggactccaggatgag
cacatcacagacctgcttgtgtttggctttctccaaaactgctccatctgtaatttccac
aaagagctgaaggtgctgggccatgacctgcctgtgccaacatacctgcgggaaggcccc
gacgacgaactgcagacagatggcaatctttatagccactttgtcctggaaggcaggagg
acagattctgagagccaagaggaaatcatccagaacatcgccaggcagctcgcccagata
ggggacacgatggagtgcagaatccccccaacactggtgaaccgcctggcagagcagttc
atgaatggggacctgtcagaggaagacagaaggaggtgcctggccactgcactggaccag
ctcatgcagacgttccctaaagacatggagaaggagaaggccatgctgatgttgaccctg
ctcttggccaaaaaggtggccgatcacatgccgtccttgctccaggatgtctttcgcacg
acagtgaattttattaaccagaacctgctcacctacgtgaggaacttgttcagaaacgag
atggactga

DBGET integrated database retrieval system