KEGG   Hipposideros armiger (great roundleaf bat): 109373515
Entry
109373515         CDS       T04661                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin 3
  KO
K09290  tropomyosin 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04260  Cardiac muscle contraction
hai04261  Adrenergic signaling in cardiomyocytes
hai05200  Pathways in cancer
hai05216  Thyroid cancer
hai05410  Hypertrophic cardiomyopathy
hai05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109373515 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    109373515 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109373515 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    109373515 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109373515 (TPM3)
   05414 Dilated cardiomyopathy
    109373515 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hai04812]
    109373515 (TPM3)
Cytoskeleton proteins [BR:hai04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     109373515 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ ERM TMF_DNA_bd ATG16 CENP-F_leu_zip HrpB7 SlyX MAD DUF745 Crescentin Fib_alpha BORCS7
Other DBs
NCBI-GeneID: 109373515
NCBI-ProteinID: XP_019482916
LinkDB
Position
Un
AA seq 290 aa
MEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDKY
SEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTE
ERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAE
FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSIASLQPT
NT seq 873 nt   +upstreamnt  +downstreamnt
atggaggccatcaagaaaaagatgcagatgctgaagctggacaaggagaatgctctggac
cgggcagagcaagctgaagccgagcagaagcaggcggaggaaagaagtaaacagctggaa
gatgagctggcagccatgcagaagaagctgaaagggacagaagatgagctggacaagtat
tctgaagctttgaaggatgcccaggagaagctggagctggcagagaagaaggcagctgat
gctgaggctgaggtggcgtccttgaaccgtcgaatccagctggttgaagaggagctggat
cgcgcccaggagcgcctggccaccgccctgcaaaagctggaggaagctgagaaggctgcc
gatgagagcgagagaggtatgaaggttattgaaaaccgagccttaaaagatgaagaaaag
atggaactgcaggaaatccaactcaaagaagccaagcacatcgcagaagaggcagatagg
aagtatgaggaggtggctcgtaagttggtgattatcgagggggacttggaacgcacagag
gagcgagctgaactggcagagtcccgttgccgagagatggatgagcagatcagactgatg
gaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaaaaagaagacaaa
tacgaggaagagataaagattcttactgataaactcaaggaggcagagacccgggcggag
tttgccgagaggtcggtagccaagctggaaaagaccatcgatgatttggaagatgagctc
tatgcccagaaactgaagtacaaggccattagcgaggagctggaccacgccctcaatgac
atgacctctatagcgtctctacagccaacttga

KEGG   Hipposideros armiger (great roundleaf bat): 109379137
Entry
109379137         CDS       T04661                                 

Gene name
TPR
Definition
(RefSeq) translocated promoter region, nuclear basket protein
  KO
K09291  nucleoprotein TPR
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03013  RNA transport
hai05014  Amyotrophic lateral sclerosis
hai05200  Pathways in cancer
hai05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109379137 (TPR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109379137 (TPR)
  09162 Cancer: specific types
   05216 Thyroid cancer
    109379137 (TPR)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109379137 (TPR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109379137 (TPR)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     109379137 (TPR)
SSDB
Motif
Pfam: TPR_MLP1_2 Crescentin TFIIA
Other DBs
NCBI-GeneID: 109379137
NCBI-ProteinID: XP_019491040
LinkDB
Position
Un
AA seq 2487 aa
MTRAAPLPSPQRLSQSDCGRHPAPFRALLREWRYPGAGRPALPGPMPSSGSVSRSRQRGR
PMASRSFDGSRRGSLRRAGAREPPGEVAEAAPQTCGSWSSSLSSGSAPSAAAAAAPGPTD
MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKR
LSHSQERLVNETRECQSLRLELEKLNSQLKALTEKNKELEIAQDRNASIQSQFTRTKEEL
EAEKRDLIRTNERLSQELEYLTEDVKRLNEKLKESNATKGDLQLKVDELQASDVSVKYRE
KRLEQEKELLHNQNTWLNTELKSKTDELLALGREKGNEILELKCNLENKKEEVSRLEEQM
NGLKTSSENLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKS
NELTRAVEELHKLLKEAGEANKAIQDHLLEVEESKEHMEKDMLDKIGKLEKELENANDLL
SATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN
KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKHSS
VLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSY
RNIEELQQQNQRLLVALRELGETKEREEQETTSSKISELQLKLESALTELEQLRESRQHQ
MQLVDSIVRQRDMYRILLSQTTGVVIPLHASSLDDISLVSTPKRSSTSQTVSTPAPVPII
ESAEAIEAKAALKQLQEIFENYKKEKIDNEKIQNEQLEKLQEQVTDLRSQNTKISTQLDF
ASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVR
AENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQ
IEKLEHEIAHLKKKLENEVEQRHALTRNLDVQLLDTKRQLDTETSLHLNTKELLKNAQKE
IATLKQHLSNMEVQLASQSSQRTGKGQPSNKEDVDELLSQLRQTEEQVNDLKERLKTSAS
NVEQYRAMVTSLEESLNKEKQVTEEVHKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQD
DKRKAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQN
KYERELMLHAADVEALQAAKEQVSKMASARQHLEETTQKAESQLLECKASWEERERTLKD
EVSKCVSRCEDLEKQNRLLHDQIEKLSDKVVASVKEGIQGPLNVSFTEEGKSQEQILEIL
RFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHE
ELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGM
LQAEKKLLEEDVKRWKARNQHLVNQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEVGRLKA
EIARSNASLTNNQNLIQSLKEDLSKVRAEKENIQKDLDAKIIDIQEKVKTITQVKKIGRR
YKTQYEELKAQQDKVMEASAQSSGDHQEQHVSVQEMQELKETLNQAEAKSKSLESQVENL
QKALSEKETEARNFQDQAVQLQSELARLRQDLQDRTTQEEQLRQQITEKEEKTRKAIVAA
KSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRMTALKSQYEGRISRLERELREH
QERHLEQRDEPQEPTNKVPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPSK
VTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVEHVPV
FGSTSGSVRSTSPNVQPSIPQPILTVQQQTQATAFVQPTQQSHPQIEPANQELSPNIVEV
VQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASDQVSDDTVEMPLPKKLK
SVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSMGEGVTQEDYTPMEDSEETSQSLQIDL
GPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHEDYEEDEEEDDDDEDDTG
MGDEGDDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGGESNQRAADSQNSGEG
NTGTAESSFSQEISREQQPSSASERQTPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQR
IQMPRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAG
VPRFRFGPPEDMPQTSSSHSDLGQLASQGELSLGLGMYETPLFLAHEEESGGRSVPTTPL
QVAAPVTVFTESTAADASEHASQSVPMVTTSTGTLSTTNETAAGDDGDEVFVEAESEGIS
SEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRRVRLQTTLRQGV
RGRQFNRQRGVSHAMGGRGGINRGNIN
NT seq 7464 nt   +upstreamnt  +downstreamnt
atgacgcgtgcagcccccctgccttcaccgcagcgcctcagccaaagcgactgcggtcgc
caccccgcccccttccgggcactattgagagagtggcggtatcccggcgccggccggccg
gccctgccgggaccgatgccctctagtggctcagtgtctagaagccgccaaagaggacga
cccatggcatcgcgaagctttgatgggtcccgccgcgggagtctccggcgggccggagcg
cgcgagccacccggcgaggtggcggaggcggctccccagacttgtgggtcctggtcttcg
tctctgtcctccggttctgctccatcggccgctgctgctgcggcccccggcccaaccgac
atggcggcggtattgcagcaagtcctggagcgcacggaactgaacaagctgcctaagtcg
gtccagaacaaacttgaaaagttcctggccgaccagcaatccgagatcgatggcctgaag
gggcggcacgagaaattcaaggtggagagcgaacaacagtacttcgagatagagaaaagg
ctgtctcacagtcaggagagacttgtgaatgaaaccagagagtgccaaagcttgcggctt
gagctggagaagctcaacagtcaactgaaggcactaactgagaaaaacaaagaacttgaa
attgctcaggatcgcaatgcttccattcagagccagtttacaaggacaaaggaagaatta
gaagctgagaaaagagatttaattagaaccaatgagagactatctcaagaacttgaatat
ttaacggaggatgttaaacgtctaaatgaaaaacttaaagaaagcaatgcaacaaaaggc
gatcttcaattaaaagtggatgaacttcaagcttctgatgtttctgttaagtatcgggaa
aaacgtttggagcaagaaaaggaattgttacataatcagaatacatggctgaatacagag
ttgaaatccaaaactgatgaacttctggctctgggtagagaaaaaggaaatgagattcta
gagcttaaatgtaatcttgaaaacaaaaaagaggaggtttctagattggaagaacagatg
aatggcttgaaaacatcaagcgagaatcttcaaaagcatgtagaggatctgttgaccaaa
ctgaaagaggccaaggaacagcaggccagtatggaagagaaattccacaatgaactaaat
gcccacataaagctctctaacctatacaagagtgctgctgatgactcagaggcaaagagc
aatgaactgacccgagcagtggaagaactgcacaaacttctgaaagaagctggagaagca
aataaagcaatacaggatcatcttctagaggtggaagaatcgaaagagcacatggaaaaa
gacatgcttgataaaatagggaaactggagaaggaattagagaatgcaaatgacctgctt
tctgccacaaaacgtaaaggagccatattatctgaagaagagctcgcagccatgtctcct
actgcagcagctgtagctaagatagtgaaacctggcatgaaattaactgagctgtataat
gcttatgtggaaactcaggatcagttgcttttggagaaactagagaacaaaagaattaat
aagtacttagatgaaatagtgaaagaagttgaagccaaagcaccaattttgaaacgccag
agggaggaatatgaacgtgcacagaaagctgtggcaagtttatctgttaagcttgaacaa
gctatgaaggagattcagcgattgcaggaggacactgacaaagccaacaaacattcatct
gtacttgaaagagacaatcagagaatggaaatacaaataaaagatctttcacaacagatt
agagtgcttttgatggaacttgaagaagcaaggggtaaccatgtaattcgtgatgaggaa
gtaagctctgctgatataagcagttcatctgaagtaatatcccagcatctagtatcttac
agaaatattgaagagcttcaacaacaaaatcaacgtctcttagtggctcttagggaactt
ggggaaactaaagaaagggaagaacaagaaacaacttcatccaagatcagtgagcttcag
ctcaaacttgagagcgccctcactgaattggaacaactccgtgagtcacgacaacatcag
atgcagcttgttgattccatagttcgtcagcgtgatatgtaccgtattttgttgtcacaa
acaacaggagttgtcattcctttacatgcttcaagcttagacgatatttctcttgtgtca
actccaaaacgttcaagtacatcacagactgtttccactcctgctccagtgcctataatt
gagtcagcagaggctatagaagccaaggctgcccttaaacagttgcaggaaatttttgag
aactacaaaaaagaaaagatagataatgaaaaaatacaaaatgagcagcttgagaaactc
caggaacaagtcacagatttgcgatcacaaaacaccaaaatttctacccagctagatttt
gcttctaaacgttatgaaatgttacaagataatgttgaaggctatcgccgagaaataaca
tccctacatgagagaaatcagaaactcaccgcaacaactcaaaagcaggagcagatcatc
aatacaatgacgcaagatttgagaggagcaaacgaaaagcttgctgttgccgaagtaaga
gcagaaaatttgaaaaaggaaaaggaaatgcttaaattgtcagaagttcgcctttctcag
caaagagagtctttgttagctgaacaaagagggcaaaacttgctgctaactaatctgcaa
acaattcagggaatactagagcgatctgaaacggagaccaaacaaaggcttagtagccag
atagaaaaactggaacatgagatagctcatcttaaaaagaagttggaaaacgaggtggaa
caaaggcacgcgcttactcgaaatctagatgttcaacttttagatacaaagagacagctg
gataccgagacaagtcttcaccttaacacaaaagaactattaaaaaatgcccaaaaggaa
attgctacgttgaaacagcacctcagtaatatggaagtccagcttgcttctcagtcctca
cagagaactggtaaaggtcagcctagcaacaaagaagatgtggatgaacttctgagtcaa
ctaaggcaaacagaagagcaagtgaatgatttgaaggagagactcaaaacaagtgccagt
aacgtggagcagtaccgagcaatggttactagtttagaagagtcccttaacaaggaaaag
caggtaacagaagaagtacataaaaatattgaagttcgtttaaaagagtcagctgaattt
cagacacagctggaaaagaagttgatggaagtagagaaggaaaaacaggaacttcaggat
gacaagagaaaagccatagagagcatggaacaacagttatctgagttaaagaaaacactt
agtagtgttcagaatgaagtacaagaagctcttcagagagcaagcacagctctgagtaat
gaacagcaagccagacgtgactgtcaggaacaagctaaaatagctgtggaagctcagaac
aagtatgagcgagaactgatgctgcatgctgccgacgtggaagcactgcaggctgccaag
gaacaggtttccaaaatggcatcggcccgtcagcatttggaagaaacaacccagaaagca
gaatcacagttgttggagtgtaaagcatcttgggaggaacgagagagaacgttaaaggat
gaagtttccaagtgtgtgtctcgctgtgaagacctagagaaacaaaatcgattacttcac
gatcaaattgaaaaattaagtgacaaggtcgttgcctctgtgaaggaaggcatacagggt
ccgctgaatgtatctttcactgaagaaggaaaatctcaagaacaaattttagaaattctc
agatttatacgacgagagaaagaaattgctgaaacgaggtttgaggtggctcaggttgag
agtctgcgttaccgacaaagggttgagctcttagaaagagagctacaggaacttcaggac
agcctcaacgctgaaagggagaaagtccaggtaactgcaaaaacaatggcccagcatgaa
gaactgatgaagaaaactgaaacaatgaacgtagtgatggagaccaataagatgctaaga
gaagaaaaggagaggctagaacaggatctacagcagatgcaagcaaaggtgaggaaactg
gaattagatattttacccttacaagaagcaaatgctgagctgagtgagaaaagcggtatg
ttgcaagcagagaagaaattattagaagaagatgtcaagcgttggaaagcacgtaatcag
catctagtaaatcaacagaaagatccagatacagaagaatatcggaagctcctttctgaa
aaggaagttcatactaagcgtattcaacagttaactgaagaagttgggagacttaaagct
gagattgcaagatcaaatgcatctttgactaacaatcagaacttaatccagagtctaaag
gaagatttaagtaaagtaagagctgaaaaggaaaacatccagaaggacttagatgccaaa
ataattgatatccaagaaaaagtcaaaactattactcaagtcaagaaaattggtcgtagg
tacaagactcaatatgaagaacttaaagcacaacaggataaggtcatggaggcctcagct
cagtcttccggagaccatcaggaacagcatgtctcggtccaggaaatgcaggagctcaaa
gaaacccttaaccaagctgaagcaaagtcaaaatcacttgagagtcaagtagagaatctg
cagaaggcgttatctgaaaaagagacagaagcacgaaatttccaagatcaggctgtgcag
cttcaatctgaacttgcacgacttcgtcaggatcttcaggacagaaccacacaggaggag
cagctccgacagcagataactgaaaaggaagaaaagacaagaaaggctattgtagcagcg
aaatcaaaaattgcacatttagctggtgtaaaagatcagttaactaaagaaaatgaggag
cttaaacaaaggaacggagccttagatcagcagaaagatgaactggatgttcgtatgact
gctcttaagtcccaatacgaaggtcgaattagtcgcttggaaagagaactccgggagcat
caggagagacacctcgagcaaagagatgagcctcaagaacctactaataaggtcccggaa
cagcagagacagattacactgaagacaactccagcgtctggtgaaagaggaattgccagc
acatcagacccaccaacagctaatatcaagccaactcctgttgtatctactccaagtaaa
gtgacagctgcagctatggctgggaataagtcaacacccagggctagtatccgcccaatg
gttacacctgcaactgttacaaatcctactactactccaacagctacagtgatgcccact
acacaagtggaatcacaagaagctatgcaatcagaagggcctgtggaacatgttccggtt
tttggaagcacaagtggatctgtccgttctacgagccctaatgtccagccttctatccct
cagcccattttaactgttcagcagcagacacaggctacggcttttgtgcagcccactcaa
cagagtcatccacagattgagcctgcaaatcaagagctgtccccaaacatagtggaggtg
gttcagagctcgccagtggagcggccttctacttccacagcagtatttggcactgtttca
gctaccccaagttcttcattgcctaagcgtacacgtgaagaagaagaggatagcaccata
gaagcatcagaccaggtctctgatgatacagtggaaatgcctcttccaaagaaattgaaa
agtgttacacctgtaggaactgaggaagaagttatggcagaagaaagtactgatggagag
gtagagactcaagtatacaaccaagattctcaagattccatgggagaaggagtcactcag
gaagattatactccaatggaagacagtgaagaaacctctcaatctttacaaatagacctt
ggacccctccagtcagatcagcaaacaacaacttcatcccaagatggtcaaggcaaaggt
gatgatgtcatcgtaattgacagtgatgatgaagaggaggatgatgatgaaaatgatggc
gaacatgaggattatgaagaagatgaggaagaggatgatgatgatgaagatgacacaggg
atgggcgacgagggtgatgatagtaacgaaggcaccggtagtgcagatggcaatgatgga
tatgaagccgatgatgctgagggtggtgatgggactgatccaggtacagaaacagaagaa
agtatgggtggaggtgaaagtaatcagagagctgctgattctcaaaacagtggtgaagga
aatacaggtactgcggagtcctctttttcccaggagatttctagagaacagcagccatcg
tcagcatctgaaagacagacccctcgcgcgcctcagtcccctagaaggccaccacaccca
ctgccccccagactgaccattcatgccccacctcaagagttgggaccaccagtgcagaga
attcagatgcctcggaggcagtctgtaggacgtgggcttcagttgacaccaggaataggt
ggcatgcagcagcacttttttgacgatgaagataggacagtgccaagtaccccgacgctt
gtcgtgcctcatcgtactgacggattcgctgaggcaattcattccccacaggtcgctggt
gttcctagattccgatttgggccacctgaagatatgccacagacaagctctagtcactct
gatctcggtcaacttgcttctcaaggagaattgtctttaggtttgggaatgtatgaaaca
ccactcttcttagctcatgaagaagagtcgggtggccgaagtgttcccacaacccctctg
caagtagcagccccagtgacggtgtttactgagagcaccgccgccgatgcttctgagcac
gcctctcagtctgttcccatggtgacaacatcgactggcactctgtccacaaccaatgaa
acagcagccggtgacgatggggatgaggtgttcgtggaggcggaatctgaaggtattagt
tcagaagcaggcctggagattgacagccagcaggaagaagagcccgtccaggcgtcggat
gagtcagaccttccttccaccagccaggaccccccttccagttcctctgtagacactagc
agtagtcagccaaagcctttcagacgagtaagacttcagacaacactgagacaaggtgtc
cgtggccgccagtttaacagacagagaggtgtgagccatgcaatgggagggagaggaggc
ataaacagaggaaatattaattaa

KEGG   Hipposideros armiger (great roundleaf bat): 109385785
Entry
109385785         CDS       T04661                                 

Gene name
TFG
Definition
(RefSeq) TRK-fused gene
  KO
K09292  protein TFG
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05200  Pathways in cancer
hai05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385785 (TFG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    109385785 (TFG)
SSDB
Motif
Pfam: PB1
Other DBs
NCBI-GeneID: 109385785
NCBI-ProteinID: XP_019503914
LinkDB
Position
Un
AA seq 394 aa
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTNIPENDTVDGREEKPAASDSSGKQSTQVMAASMSAFDPLKNQDEINK
NVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGTQTQAGQS
EGQMYQQYPQQAGYSAQQPQQYGIQYSAGYSQQTGPQQPQQFQGYGQQPTSQAPAPAFSG
QPQQLPAQPPQQYQASTYPPHTYATPTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSP
PGSNMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaacggacagttggacctaagtgggaagctaatcatcaaagctcaacttggggaggat
attcgacgaatacccattcacaatgaagatattacttatgatgaattagtgttaatgatg
caacgagttttcagaggaaaacttctgagtaatgatgaagttacaataaagtataaagat
gaagatggagaccttataacaatttttgatagttctgacctttcctttgcaattcagtgt
agtaggatactgaaattgacattatttgttaatggccaaccaagaccccttgaatcaagt
caggtgaaataccttcgccgagaactgatagaacttcgaaataaagtaaatcgcttattg
gatagtttggaaccacctggagaacctggaccttccaccaatattcctgaaaatgatact
gtggatggcagggaagaaaagcctgctgcttctgattcttcgggaaaacagtctactcag
gttatggcagcaagtatgtcagcttttgatcctttaaaaaaccaagatgaaatcaataaa
aatgtcatgtcagcatttggcttaacagatgatcaggtttcagggccccccagtgctcct
gcagaagaccgttcaggaacacccgacagcattgcttcctcctcctctgcagctcaccca
ccgggagttcagccacaacagccaccatatacaggaactcagacacaagcaggtcagagt
gaaggtcagatgtaccagcagtacccacagcaggcaggctacagtgctcagcagccgcag
cagtacggtattcagtattcagcaggctatagtcagcagactggaccccaacaacctcag
cagttccagggatatggccagcagccaacttcccaggcaccagcgcctgccttttctggt
cagcctcagcaactgcctgctcaaccgccacagcagtaccaggcgagcacttatcctcca
catacttacgctaccccaacttctcagcctactaattacactgtggctcctgcctcacaa
cctggaatggctccaagccaacccggggcctatcagccaagaccaggttttacttcacct
ccgggaagtaacatgacccctcctccaagtgggcctaacccgtatgcacgtaaccgccct
ccctttggtcagggctatacccagcctgggcctggttatcgataa

KEGG   Hipposideros armiger (great roundleaf bat): 109393379
Entry
109393379         CDS       T04661                                 

Gene name
NTRK1
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 1
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04020  Calcium signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04722  Neurotrophin signaling pathway
hai04750  Inflammatory mediator regulation of TRP channels
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05216  Thyroid cancer
hai05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109393379 (NTRK1)
   04014 Ras signaling pathway
    109393379 (NTRK1)
   04020 Calcium signaling pathway
    109393379 (NTRK1)
   04151 PI3K-Akt signaling pathway
    109393379 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109393379 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109393379 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109393379 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109393379 (NTRK1)
   05202 Transcriptional misregulation in cancer
    109393379 (NTRK1)
   05230 Central carbon metabolism in cancer
    109393379 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    109393379 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109393379 (NTRK1)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109393379 (NTRK1)
Protein kinases [BR:hai01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   109393379 (NTRK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TPKR_C2 I-set LRR_8 TrkA_TMD Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 109393379
NCBI-ProteinID: XP_019518046
LinkDB
Position
Un
AA seq 910 aa
MLRGGQRRPLGGHGRATGLGSLLAWLMLASAGAAPCPDVCCPHGPSGLRCTRVGALDSLR
HLPGIENLTELYIENETQLQHLEPSHLRGLGQLRNLSIVKSGLYFVAPDAFHFTPRLRRL
NLSFNALESLSWKTVQGLFLQELQKPADTLPGFPLSSLMQQSGGLPSLGLTLTNVTSDLN
RKNVTCWAENDVGRAEVSVQVNVSFPATVQLHNPVELHHWCIPFSVDGQPAPSLRWLFNG
STLNETSFIFTEFLEPAANETMRHGCLRLNQPTHVNNGNYTLLATNPSGRAAASVMAAFM
DNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETSFGVSVAVGLAVFACLFLSALFLVL
SKCGRRNKFGINREWRGCLPVCPTGLVSHLLLLTLPRGGRAVHMRNSASVCLGCTSACEY
VSLVPGDLSGNPLNCSCALHWLRRWAEEGLGGIREQRLPPCPRPGFLPALSNTSCGMPVL
KVWMPNGSVDVGDSVLLQCQVEGRDLEQAGWIFTELEESAVVTIWKLRAVGRALSVVLHP
DEFLEAFRLFLAGGSGSSPLVEEAKVLVYHLVSDLPGLTLSVLERLPPPPVAGAALVQCS
ALSRGPCLTMRAPLGVRHIKRRDIVLKWELGEGAFGKVFLAECHHLLPEQDKMLVAVKAL
KEASESARQDFQREAELLTMLQHQHVVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGP
DAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKI
GDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVLLWEIFTYGKQ
PWYQLSNTEAIECITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAR
APPVYLDVLG
NT seq 2733 nt   +upstreamnt  +downstreamnt
atgctgcgaggcggccagcgccggccgcttggcgggcacggccgggctacgggcctgggc
agcctgctggcctggctgatgctggcatcggcgggcgccgcaccctgccctgatgtctgc
tgcccccacggcccctcggggctgcgctgcacccgggttggggccctggatagcctccgc
cacctgccgggcatagagaacctgacggagctctacatcgagaatgagacgcagctacag
cacctggagcccagtcacctgaggggcctggggcagctgagaaacctctccatcgtgaag
agtggcctctatttcgtggctccagatgctttccatttcacccctcggctccgtcgcctg
aatctgtccttcaatgctctggagtccctgtcctggaaaaccgtccagggcctgttctta
caggagctccagaagccagctgacaccctccctggttttcccctctcttccctgatgcag
caatctggggggctgccatccctggggctgaccctgaccaacgtcaccagtgacctcaat
agaaagaacgtgacgtgctgggcagaaaacgacgtgggccgggctgaagtctcggtccag
gtcaacgtttccttccctgccaccgtgcagctgcacaacccggtggagctgcaccattgg
tgcattcccttctcggtggacggccaaccggcaccctctctgcgctggctcttcaatggc
tccacgctcaacgagaccagcttcatcttcaccgagttcctggagcctgcggccaatgag
accatgcgtcacgggtgcctgcgcctcaaccagcccacccacgttaacaacggcaactat
acgctgctggccaccaacccttcgggccgggccgccgcctcggtcatggcggccttcatg
gacaacccatttgagttcaaccctgaggaccccatcccggtctccttttccccagtggac
actaacagcacgtctggagacccggtggagaagaaggacgagacatcttttggggtctca
gtggccgtgggcctggctgtcttcgcctgcctcttcctctctgcactgtttctggtgctc
agcaaatgcggacggaggaacaagtttgggatcaaccgtgagtggaggggctgcctgcca
gtctgtcctactggcttggtttcccacctgctcttactgaccctgcctcggggagggcgg
gctgtgcacatgcggaattcagcaagcgtgtgtttggggtgtacgagcgcctgtgagtat
gtcagcctggtgccgggagacttgtcggggaatcctctgaactgttcctgtgccctacac
tggctgcggcgctgggcggaggaggggctgggcggcatccgcgaacagaggctgccaccg
tgtcccaggccggggttcttgcccgcactgtccaacaccagctgtggcatgcccgtgctg
aaggtctggatgcccaacggctctgtggacgtgggcgacagcgtgctgctgcagtgccag
gtggaggggcgggacctggagcaggctggctggatcttcacggagctggaggagtcagcc
gtggtgacgatatggaagctgagggccgtggggagggcactgtccgtggtcctgcaccca
gacgagttcttggaggccttccgtctttttctggctggcggctctggaagcagccccctc
gtggaggaggccaaggtgctcgtgtatcatcttgtttcggacctgcccgggctgacactc
agtgtgttagaacgtctcccccccccacccgtggctggcgccgcccttgtgcagtgctca
gccctgtccaggggcccctgtctgaccatgcgagcccccctaggtgttcgccacatcaag
cgccgggacatcgtgctcaagtgggagctgggcgagggcgccttcgggaaggttttcctt
gccgagtgccaccacctgctacctgagcaggacaaaatgctggtggctgttaaggcgctg
aaggaggcgtcggagagcgcgcggcaggacttccagcgcgaggcggagctgctcaccatg
cttcagcaccagcacgtcgtgcgcttcttcggcgtctgcaccgagggccgcccgctgctc
atggtgttcgagtacatgcggcacggggacctcaaccgcttcctccggtcccacgggccc
gatgccaagctgctggccggcggggaggacgtggctccaggccctctggggctggggcag
ctgctggccgtggccagccaggtcgctgcggggatggtgtacctggcgggactgcacttc
gtgcatcgggacctggccacgcgcaactgtctggtggggcagggactggtggttaagatc
ggcgatttcggcatgagcagggacatctacagcaccgactactaccgcgtgggaggccgc
accatgctgcccatccgctggatgccgcccgagagcatcctctaccgcaagttcacgacc
gagagcgacgtgtggagcttcggcgtgctgctctgggagatcttcacctacggcaagcag
ccctggtaccagctctccaacaccgaggcgattgagtgcatcacacagggacgggagctg
gagcggccacgtgcctgcccaccggaggtctatgccatcatgcggggctgctggcagcgg
gaaccccagcagcgtcacagcatcaaggatgtgcacgcccggctgcaggccctggcccgg
gcgccccctgtctacctggacgtcctgggctag

DBGET integrated database retrieval system