KEGG   Hipposideros armiger (great roundleaf bat): 109373596
Entry
109373596         CDS       T04661                                 

Gene name
CDK6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04110  Cell cycle
hai04115  p53 signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04218  Cellular senescence
hai04934  Cushing syndrome
hai05160  Hepatitis C
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05206  MicroRNAs in cancer
hai05212  Pancreatic cancer
hai05214  Glioma
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109373596 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109373596 (CDK6)
   04115 p53 signaling pathway
    109373596 (CDK6)
   04218 Cellular senescence
    109373596 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109373596 (CDK6)
   05206 MicroRNAs in cancer
    109373596 (CDK6)
   05203 Viral carcinogenesis
    109373596 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109373596 (CDK6)
   05225 Hepatocellular carcinoma
    109373596 (CDK6)
   05214 Glioma
    109373596 (CDK6)
   05220 Chronic myeloid leukemia
    109373596 (CDK6)
   05218 Melanoma
    109373596 (CDK6)
   05224 Breast cancer
    109373596 (CDK6)
   05222 Small cell lung cancer
    109373596 (CDK6)
   05223 Non-small cell lung cancer
    109373596 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109373596 (CDK6)
  09172 Infectious disease: viral
   05162 Measles
    109373596 (CDK6)
   05164 Influenza A
    109373596 (CDK6)
   05160 Hepatitis C
    109373596 (CDK6)
   05163 Human cytomegalovirus infection
    109373596 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109373596 (CDK6)
   05169 Epstein-Barr virus infection
    109373596 (CDK6)
   05165 Human papillomavirus infection
    109373596 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109373596 (CDK6)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109373596 (CDK6)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109373596 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 Kinase-like FTA2 Seadorna_VP7
Other DBs
NCBI-GeneID: 109373596
NCBI-ProteinID: XP_019483142
LinkDB
Position
Un
AA seq 186 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVL
IFQVRF
NT seq 561 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgcgccgaccagcagtacgaatgcgtggcggagatcggg
gagggagcctatggtaaggtgttcaaggcccgggacctgaagaacggaggtcgtttcgtg
gcgctcaaacgcgtgcgggtgcagacgggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttattt
gacgtgtgcacagtgtcacgaacagacagagaaaccaaactaacattagtgtttgaacat
gttgatcaagacttgaccacttatttggataaagttccagagcctggagtgcccacggaa
accataaaggatatgatgtttcagcttctccgaggcctggactttcttcattctcaccga
gtagtacaccgtgacctaaaaccacagaacattctggtgaccagcagtggacaaataaaa
ctggctgacttcggccttgcccgcatctacagttttcagatggctcttacctcagtgcta
atattccaagtccgtttctaa

KEGG   Hipposideros armiger (great roundleaf bat): 109390747
Entry
109390747         CDS       T04661                                 

Gene name
CDK4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai04110  Cell cycle
hai04115  p53 signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04218  Cellular senescence
hai04530  Tight junction
hai04660  T cell receptor signaling pathway
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04934  Cushing syndrome
hai05160  Hepatitis C
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05212  Pancreatic cancer
hai05214  Glioma
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109390747 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109390747 (CDK4)
   04115 p53 signaling pathway
    109390747 (CDK4)
   04218 Cellular senescence
    109390747 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109390747 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    109390747 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109390747 (CDK4)
   05203 Viral carcinogenesis
    109390747 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109390747 (CDK4)
   05225 Hepatocellular carcinoma
    109390747 (CDK4)
   05214 Glioma
    109390747 (CDK4)
   05220 Chronic myeloid leukemia
    109390747 (CDK4)
   05218 Melanoma
    109390747 (CDK4)
   05219 Bladder cancer
    109390747 (CDK4)
   05224 Breast cancer
    109390747 (CDK4)
   05222 Small cell lung cancer
    109390747 (CDK4)
   05223 Non-small cell lung cancer
    109390747 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109390747 (CDK4)
   04934 Cushing syndrome
    109390747 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109390747 (CDK4)
   05162 Measles
    109390747 (CDK4)
   05164 Influenza A
    109390747 (CDK4)
   05160 Hepatitis C
    109390747 (CDK4)
   05163 Human cytomegalovirus infection
    109390747 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109390747 (CDK4)
   05169 Epstein-Barr virus infection
    109390747 (CDK4)
   05165 Human papillomavirus infection
    109390747 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109390747 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109390747 (CDK4)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109390747 (CDK4)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109390747 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 109390747
NCBI-ProteinID: XP_019513178
LinkDB
Position
Un
AA seq 385 aa
MVRVGVRGPLYPAACVYGLAVESSCPRQTSSVWRLRNPLRGPHNGPPPQLPARGEGLFGG
RSLCDCRVSSDLRMATPRYVPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGG
GLPISTVREVALLRRLEAFEHPNVVRLMDVCATAQTDRETKVTLVFEHVDQDLRTYLDKA
PPPGLPVETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSY
QMALTPVVVTLWYRAPEVLLQSAYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLGKIF
DLIGLPPEDDWPRDVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLFSDLCLPSQEMLTF
NPHKRISAFRALQHSYLQKAEGNPE
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggtgagggtgggggtaagggggccgctctatcctgcggcctgtgtctatggtctggcc
gtagagtccagctgccccagacagacttccagtgtatggcgcctcaggaacccgctccgg
ggcccccataacgggccgcccccgcagctgccagcaagaggtgaaggacttttcggtggt
aggagtctttgtgattgtagggtctcctctgatctgagaatggctacccctcgatatgtg
ccagtggctgagattggtgttggtgcctatgggacggtgtacaaggcccgtgatccccac
agtggccactttgtggctctcaagagtgtgcgagtccccaatggaggaggtgctggaggg
ggccttcccatcagcacagttcgtgaagtggccttactgaggcggctggaggcttttgag
catcccaatgttgtccggctgatggatgtctgtgccacggcccaaactgatcgggagacc
aaagtgaccctggtgtttgagcatgtagaccaagacctaaggacatatctggacaaggca
cccccaccaggcttgccagtggagaccatcaaggatctgatgcgccagtttctaagaggc
ctagatttccttcatgccaactgcattgttcaccgagacctgaagccagagaacattctg
gtgacaagtggtggaacagtcaagctggctgactttggcttggccagaatctacagctat
caaatggcacttacgcctgtggttgttacactctggtaccgtgctccagaagttcttctg
cagtctgcgtatgcaacacctgtggacttgtggagtgttggctgtatctttgcagagatg
tttcgtcgaaagcctctcttctgtggaaactctgaagctgatcaattaggcaaaatcttt
gacttgattgggctgcccccagaggatgactggccccgagatgtgtctctaccccgagga
gccttctccccgagagggccccgcccagtgcagtcagtggtgcctgagatggaggagtct
ggagcacagctgctgctgttttctgacctttgcctcccctctcaggagatgctgactttt
aacccacacaagcgaatctctgccttccgagccctgcaacactcttacctacaaaaggca
gaaggtaacccagagtga

DBGET integrated database retrieval system