KEGG   Hipposideros armiger (great roundleaf bat): 109373644
Entry
109373644         CDS       T04661                                 

Gene name
TNFRSF1A
Definition
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04060  Cytokine-cytokine receptor interaction
hai04061  Viral protein interaction with cytokine and cytokine receptor
hai04064  NF-kappa B signaling pathway
hai04071  Sphingolipid signaling pathway
hai04150  mTOR signaling pathway
hai04210  Apoptosis
hai04215  Apoptosis - multiple species
hai04217  Necroptosis
hai04380  Osteoclast differentiation
hai04668  TNF signaling pathway
hai04920  Adipocytokine signaling pathway
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai05010  Alzheimer disease
hai05014  Amyotrophic lateral sclerosis
hai05022  Pathways of neurodegeneration - multiple diseases
hai05132  Salmonella infection
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05170  Human immunodeficiency virus 1 infection
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109373644 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    109373644 (TNFRSF1A)
   04668 TNF signaling pathway
    109373644 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    109373644 (TNFRSF1A)
   04150 mTOR signaling pathway
    109373644 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109373644 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109373644 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109373644 (TNFRSF1A)
   04215 Apoptosis - multiple species
    109373644 (TNFRSF1A)
   04217 Necroptosis
    109373644 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109373644 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109373644 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109373644 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    109373644 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    109373644 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109373644 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109373644 (TNFRSF1A)
   04931 Insulin resistance
    109373644 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109373644 (TNFRSF1A)
   05152 Tuberculosis
    109373644 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109373644 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    109373644 (TNFRSF1A)
   05164 Influenza A
    109373644 (TNFRSF1A)
   05160 Hepatitis C
    109373644 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    109373644 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    109373644 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109373644 (TNFRSF1A)
   05165 Human papillomavirus infection
    109373644 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109373644 (TNFRSF1A)
   05142 Chagas disease
    109373644 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hai04050]
    109373644 (TNFRSF1A)
   04090 CD molecules [BR:hai04090]
    109373644 (TNFRSF1A)
Cytokine receptors [BR:hai04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109373644 (TNFRSF1A)
CD molecules [BR:hai04090]
 Proteins
  109373644 (TNFRSF1A)
SSDB
Motif
Pfam: TNFR_c6 Death Papilloma_E5A
Other DBs
NCBI-GeneID: 109373644
NCBI-ProteinID: XP_019483212
LinkDB
Position
Un
AA seq 636 aa
MGLPTVPGLLLPLVLLALLVEISPSGVTGLVPHFRNREKRDSKCPQGKYSHPQNNSICCT
KCHKGTYLYNDCPGPGLDTDCRKCENGTFTAVENYFRQCFSCRKCRKEMGQEELSPCTVD
QDTVCGCKKNQYQKHWNGDLFRCLNCSLCLNGTRQIPCKEKQNTVCACHKGFFLRDNECV
SCDNCKPNTECVKFCQTPSEIWSPDKDSQDTVLPQVLLALLVEISPSGVTGLVPHFRNRE
KRDSKCPQGKYSHPQNNSICCTKCHKGTYLYNDCPGPGLDTDCRKCENGTFTAVENYFRQ
CFSCRKCRKEMGQEELSPCTVDQDTVCGCKKNQYQKHWNGDLFRCLNCSLCLNGTRQIPC
KEKQNTVCACHKGFFLRDNECVSCDNCKPNTECVKFCQTPSEIWSPDKDSQDTGTAVLLP
LVIFLALCLLSLLFMGFVCRFQRWKPKLLSIFCGESTPPNEGDPEHPASASSFSPIPSSP
FNPTDWSNFRPASPPKEKVLPHQEIGPLLSAAPASTPIPTPLQKWEDRAHTQRADTDPAT
LYAVVDRVPPSRWKEFMRRLGLSENEIERLELQNGRCLREAHYSMLATWRQRTPRREATL
ELLGLVLRDMDLLGCLESIQEALCGPTSLSPVSRLP
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgggcctccccaccgtgcctggcctgctgctgccactggtgctcctggctctgttggtg
gaaatatccccctccggggttactggactggtccctcacttcaggaaccgggagaaaaga
gacagcaagtgtccccagggaaaatacagccaccctcaaaacaattccatttgctgtacg
aagtgtcacaaagggacctacctgtacaatgactgtcccggcccagggctggacacggac
tgcaggaagtgtgaaaatggcacctttactgctgttgagaactacttccgtcaatgcttc
agctgccggaagtgccgaaaagaaatgggccaggaggagctttctccttgcacagtggac
caggacactgtgtgtggctgtaagaagaaccagtaccagaaacattggaatggcgatctt
ttccggtgcctgaactgcagtctctgcctcaatggcacgaggcaaatcccatgcaaggaa
aaacagaacaccgtatgtgcctgccacaaggggttcttcctaagagacaacgaatgtgtg
tcctgtgataactgtaagccaaacacggagtgcgtgaagttttgccaaaccccatctgaa
atctggagccctgataaggactctcaggacacagttcttccccaggtgctcctggctctg
ttggtggaaatatccccctccggggttactggactggtccctcacttcaggaaccgggag
aaaagagacagcaagtgtccccagggaaaatacagccaccctcaaaacaattccatttgc
tgtacgaagtgtcacaaagggacctacctgtacaatgactgtcccggcccagggctggac
acggactgcaggaagtgtgaaaatggcacctttactgctgttgagaactacttccgtcaa
tgcttcagctgccggaagtgccgaaaagaaatgggccaggaggagctttctccttgcaca
gtggaccaggacactgtgtgtggctgtaagaagaaccagtaccagaaacattggaatggc
gatcttttccggtgcctgaactgcagtctctgcctcaatggcacgaggcaaatcccatgc
aaggaaaaacagaacaccgtatgtgcctgccacaaggggttcttcctaagagacaacgaa
tgtgtgtcctgtgataactgtaagccaaacacggagtgcgtgaagttttgccaaacccca
tctgaaatctggagccctgataaggactctcaggacacaggcaccgcagtgctgttgccc
ctggtgatcttcttggctctctgccttttatccctcctgttcatgggttttgtatgccgc
ttccaacgatggaagcccaagctcctctccattttttgtggggaatcgacacctccaaat
gagggggaccccgagcacccggcctcagcttcaagcttcagtcccatccccagctccccc
ttcaaccctaccgactggtccaatttcaggcctgcatcaccccccaaagagaaggtttta
ccccaccaggagattggccccctcctctcagcggctccagcctccacccccatccccacc
cctcttcagaagtgggaggacagggcccacacacagcgcgctgacaccgacccggcaacg
ctgtatgcggtggtggatcgcgtgcccccgtcgcgctggaaggagttcatgcggcggctg
gggctgagtgagaacgagattgagaggctggagctacagaacgggcgctgcctgcgcgaa
gcgcattacagcatgctggcgacctggcggcagcgcacaccacgacgagaagccacactg
gagctgctgggccttgtgctccgcgacatggacctgctcggctgcctggagagcatccag
gaggcactgtgtggccccacctccctctcacccgtctcccgcctgccctga

DBGET integrated database retrieval system