KEGG   Hipposideros armiger (great roundleaf bat): 109373782
Entry
109373782         CDS       T04661                                 

Gene name
KMT5C
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00310  Lysine degradation
hai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109373782 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109373782 (KMT5C)
Enzymes [BR:hai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     109373782 (KMT5C)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109373782 (KMT5C)
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 109373782
NCBI-ProteinID: XP_019483466
LinkDB
Position
Un
AA seq 510 aa
MRRWKGLTKSYTVYKWRGESTCPGYFPSCCFVLPALGWRQHGPWDIMGPDRVTARELCEN
DDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRDLEAAYRALTLGGWM
AHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEK
LELLVGCIAELREADEELLRVGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPA
DGNSACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGEGAFRLRPREHLPPRP
LDKYQLRETKRRMLQGLGSSRQTLLSPWACAHPSSLRRDLFCAACQPLRPLACGTHPDTS
PLWLPWLLQPQLRVRPRRRRRPQPRPVPMHPVLRAARISLHRWGGCGPHCRLEAEAVVAL
GPAPHACWAPQQDWHWARRYGLPYVVRVDLSRVAPAPPATATATPVPTGTPGPIPIPKQA
LAFAPFSPPKRLRLVVSHGSIDLDVNSDGP
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgaggagatggaagggattgacaaagtcctacacagtttataagtggcgtggagaaagc
acatgcccagggtacttccccagctgctgctttgtgctccctgctcttggttggaggcag
catggtccatgggacatcatggggcccgatagagtgacagccagagaactgtgtgagaac
gacgacctcgccaccagcctcgttctggacccctacctaggcttccgcacccataagatg
aatgtcagccctgtgccccccctgcggcgacagcaccacctgcgctcagcactggaggct
ttcctgaggcagcgggacctggaggctgcataccgggccctgacgctgggaggctggatg
gcccactacttccagagccggggcccgcggcaggaggctgccctcaagacccacatctat
cgctacctccgtgccttcctgcctgaaagtggctttaccatcctgccctgtacccgttat
tccatggagacgaatggagccaagattgtgtctacccgagcttggaagaagaacgagaaa
ctggagctgctggtgggctgcatcgcggagctgcgggaggccgatgaggagctgctgagg
gtgggcgagaatgatttcagcatcatgtactccacccgcaagcgcagcgcccagctgtgg
ctgggcccagcagccttcatcaaccatgactgcaaacccaactgcaagtttgtgcccgca
gatgggaactcagcctgcgtgaaggtgctccgggacattgagcctggtgatgaggtgacc
tgcttctacggtgaaggcttctttggtgaaaagaacgagcactgtgaatgctacacctgc
gagaggaaaggggaaggagcttttcgcctgcggcccagggagcacttaccaccacggccc
ttggacaagtaccagctccgggagaccaagcggaggatgctgcagggcctgggcagcagc
cggcaaaccctgctgagcccatgggcttgtgcccacccatcctctctgcgcagggacctg
ttctgtgccgcctgccagcccctgcgccccctggcctgtggcacccaccccgatacctcg
ccactctggctcccatggctgttgcagccccagctccgagtacgtccccggaggcgccgt
cgaccccagccccggccggttcccatgcaccctgttctccgtgctgcccgtatctccctg
cacaggtggggaggctgtggcccacactgccgcctggaagcagaggccgtggtggccctg
ggcccggccccccatgcctgctgggccccccagcaggactggcactgggcccggcgctac
gggctgccttacgtggtacgtgtggacctgagccgtgtggccccagccccacctgccact
gccactgccactccggtccccaccgggaccccaggccccatccccatccccaagcaggcc
cttgccttcgcacccttctccccacccaagcgcctgcggctggtggtcagccacggctcc
atcgacctagatgtcaacagtgatggaccatga

DBGET integrated database retrieval system