KEGG   Hipposideros armiger (great roundleaf bat): 109374070Help
Entry
109374070         CDS       T04661                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04371  Apelin signaling pathway
hai05034  Alcoholism
hai05165  Human papillomavirus infection
hai05169  Epstein-Barr virus infection
hai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109374070 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    109374070 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    109374070 (HDAC4)
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    109374070 (HDAC4)
   05165 Human papillomavirus infection
    109374070 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109374070 (HDAC4)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109374070 (HDAC4)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109374070 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 109374070
NCBI-ProteinID: XP_019483916
LinkDB All DBs
Position
Un
AA seq 1241 aa AA seqDB search
MVLGWEASAGDTGRREALSSSDGLSGRDQPVELLNPARVNHMPSTVEVASALPLQVAPPA
VPMDLRLDHQFPLPVAEPALREQQLQQELLALKQKQQLQRQLRDDNKDVKPRATVLCPHS
SLSRRAHSEKEAGGVQGLSGVAVVRASSNLGSLASARASSHAPELRPEGRLEAHVANEGG
VGSACLLPISLRSPRSCVAGPASQSWRPQTDARCLAPCLQARPSGHCQAAGLEAEQHQAG
RPGHGAGAARAALGRRVLSPWSELRADSSEHQQELLAMKHQQELLEHQQKLERHRQEQEL
EKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRSLNHCISSDPRYWY
GKTQHSSLDQSSPPQSGVSASYNHPILGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAER
RSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAPSSPNNSSGSVSAENGITPAIPSL
QAEASLAHRLVAREGSMAPLPLYTSPSLPNITLGLPATGPSAGAAGQQDAERLALPGLQQ
RISLFPGSHLAPYLSTAPLERDGGTAHSSLLQHVVLLEQPPAQTPLVTGLGALPLHAQPL
VGADRLSPSVHKLRQHRPLGRTQSAPLPQSAQALQQLVVQQQHQQFLEKHKQQFQQQQLH
MGKMIPKPSEPTRQPESHPEETEEELREHQALLEEPYLDRLSGQKEAHAQAGVQVKQEPL
ESDGEEAEPPRGAEPGQRQPTEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGG
HRPLSRAQSSPASATFPMSVQEPPSKPRFTTGLVYDTLMLKHQCACGNTNSHPEHAGRIQ
SIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLT
SVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHH
AEESTPMGFCYFNSVAVAAKLLQQRLNVSKTLIVDWDVHHGNGTQQAFYSDPSVLYISLH
RYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRMVVMPIANEFG
PDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRIVLALEGGHDLTAICD
ASEACVSALLGDELDPLPEKVLQQRPNANAVRSVEKVIEIHSQYWRSLQRLSSTAAYSLV
EAQKCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgggctgggaggcgtctgcaggagacacagggagacgggaggctctgtcctcc
tcagatggactttctggccgagaccagcctgtggagctgctgaaccctgcccgcgtgaac
cacatgcccagcacggtggaggtggcctcagcgctgcctttgcaggtggccccgccggcc
gtgcccatggacctgcgcctggaccaccagttcccgctgcccgtggccgagcccgccctg
cgcgagcagcagctgcagcaggagctcctggcgctgaagcagaagcagcagctgcagagg
cagctccgtgacgacaataaggacgtgaagccccgtgccacagtcctgtgtccccacagc
agcctgagcagacgggctcactccgaaaaggaggcaggtggagtgcagggtttgagcgga
gtggcggtggtcagggccagctccaacctgggcagcctggcctcagcacgggcctccagc
cacgcgccagagctccgccccgaaggccgcctggaagcccacgtggccaacgagggaggc
gtgggaagtgcctgcctgcttccaatatccctgcggtccccccgctcgtgtgtggccgga
ccggccagccagagctggaggccgcagacggatgctcgctgcctggccccgtgtctgcag
gctcggccatcaggacactgccaggcagcggggctggaggcggagcagcaccaggcgggc
cggccaggccacggagcaggcgcagcccgggcagccctgggccggcgagttctcagcccc
tggagcgagctgagggctgacagcagtgagcaccagcaggagctgctggccatgaagcac
cagcaggagctgctagagcatcagcagaagctggagcggcaccgccaggagcaggagctg
gagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaaaggcaaagag
agtgccgtggccagcacagaagtgaagatgaagttgcaggagtttgtcctgaacaaaaag
aaggcgctggcgcaccggagcctgaaccactgcatctccagcgacccccgctactggtac
gggaaaacacagcacagctccctggaccagagctccccgccccagagcggggtgtcggct
tcctacaaccacccgatcctgggcatgtacgacgccaaagatgacttccctctcagaaag
acagcttctgaacccaacctgaaattacggtctcggctaaagcagaaagtggctgagaga
cggagcagccccctgctgcgcaggaaagacgggccggtggtcaccgctctgaagaagcgt
ccgttggatgtcacagactcagcctgcagcagcgccccgggctctgcgcccagctcaccc
aacaacagctccgggagcgtcagcgcggagaacgggatcacgcccgccatccccagcctc
caggccgaggccagcttggcgcaccgactagtggcccgagagggctccatggccccgctc
cccctctacacgtcaccatccttgcccaacatcacgctgggactgcccgccaccggccct
tctgctggggcggccggccagcaggacgccgagagacttgccctcccgggcctccagcag
cgcatctccctgttccctggctcccacctggctccctacctgagcacggcgcccctcgag
cgggacggcgggacggcccacagctctctgctgcagcacgtggtcttgttggagcagccg
cctgcacagacgcccctcgtcacaggcctgggggcgctgcccctgcacgcgcagcccctg
gtgggcgcagaccggctgtccccatctgtgcacaagctgcggcagcaccgcccgctggga
cgcacgcagtcggcgcccctgcctcagagcgcgcaggccctgcagcagctggtggttcag
cagcagcaccagcagttcctggagaagcacaagcagcagttccagcagcagcagctgcac
atgggcaagatgatccccaagccgagcgagcccacccggcagcccgagagccaccccgag
gagacagaggaggagctccgcgagcaccaggccctcctggaggagccctacctggaccgg
ctgtcggggcagaaggaggcgcatgcgcaagccggcgtgcaggtgaagcaagagcccctg
gagagtgacggcgaggaggcggagccgccgcggggggcggagcccgggcagcgccagccc
accgagcaggagctgctcttcagacagcaagcgctcctcctggaacagcagcggatccac
cagctgaggaactaccaggcctccatggaggccgccggcatccccgtgtccttcggcggc
caccggcctctgtcccgggcacagtcctctcccgcctcggccaccttccccatgtctgtg
caggagccgcccagcaaaccgaggttcaccacaggcctggtatacgacacgctcatgttg
aagcaccagtgcgcctgcgggaacaccaacagccacccggagcacgccggcaggatccag
agcatctggtcccggctgcaggagaccggcctgcgcggcaaatgcgagtgtatccgcgga
cggaaggccaccctggaggagctgcagaccgtgcactcagaggcacacaccctgctctac
ggcacgaaccccctcaacaggcagaaactggacagtaagaaacttctaggctcgctgacg
tccgtgtttgtcaggctgccctgtggtggtgtcggggtggacagcgacaccatctggaac
gaggtgcactcgtccggggcggcgcgcctggccgtgggctgcgtggtggagctcgtcttc
aaggtcgccaccggggagctgaagaacggctttgctgtggtccgccctcctggacaccac
gcggaggagagcacgcccatgggcttctgctacttcaactccgtggccgtcgccgccaag
ctcctacagcagaggctgaacgtgagcaagacgctgatcgtggactgggatgtgcaccac
ggaaacgggacccagcaggccttctacagcgacccaagcgtcctgtacatctcgctgcac
cgctatgacgacgggaacttcttcccgggcagcggggcgcctgacgaggtgggcacaggg
ccgggcgtgggcttcaacgtgaacatggctttcaccggtggcctcgacccccccatggga
gacgctgagtacttggcagccttcagaatggtcgtcatgccgattgcaaacgagtttggc
ccggatgtggtgctggtgtcgtcaggctttgacgccgtggagggccaccccacgccgctg
ggcggctacaacctctccgccaaatgtttcgggtacctgacgaagcagctgatgggcttg
gcaggcggacggattgttctggccctggagggcggccacgacctcacggccatttgcgac
gcctcagaagcatgtgtttctgctttgctgggagacgagcttgatcctctcccagaaaag
gttttacagcagagacccaatgcgaacgccgtacggtccgtggagaaggtcattgaaatc
cacagtcagtactggcgctccctgcagcgtctgtcctccacggcggcctactcgctggtc
gaggcccagaagtgcgagaacgaagaagctgagactgtcacagccatggcctcactgtcc
gtgggcgtgaagccggccgagaagaggcccgacgaggagccgatggaggaggagccgccc
ctgtag

DBGET integrated database retrieval system