KEGG   Hipposideros armiger (great roundleaf bat): 109374070Help
Entry
109374070         CDS       T04661                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04371  Apelin signaling pathway
hai05034  Alcoholism
hai05165  Human papillomavirus infection
hai05169  Epstein-Barr virus infection
hai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109374070 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    109374070 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    109374070 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    109374070 (HDAC4)
   05165 Human papillomavirus infection
    109374070 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109374070 (HDAC4)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109374070 (HDAC4)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109374070 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 109374070
NCBI-ProteinID: XP_019483916
LinkDB All DBs
Position
Un
AA seq 1241 aa AA seqDB search
MVLGWEASAGDTGRREALSSSDGLSGRDQPVELLNPARVNHMPSTVEVASALPLQVAPPA
VPMDLRLDHQFPLPVAEPALREQQLQQELLALKQKQQLQRQLRDDNKDVKPRATVLCPHS
SLSRRAHSEKEAGGVQGLSGVAVVRASSNLGSLASARASSHAPELRPEGRLEAHVANEGG
VGSACLLPISLRSPRSCVAGPASQSWRPQTDARCLAPCLQARPSGHCQAAGLEAEQHQAG
RPGHGAGAARAALGRRVLSPWSELRADSSEHQQELLAMKHQQELLEHQQKLERHRQEQEL
EKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRSLNHCISSDPRYWY
GKTQHSSLDQSSPPQSGVSASYNHPILGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAER
RSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAPSSPNNSSGSVSAENGITPAIPSL
QAEASLAHRLVAREGSMAPLPLYTSPSLPNITLGLPATGPSAGAAGQQDAERLALPGLQQ
RISLFPGSHLAPYLSTAPLERDGGTAHSSLLQHVVLLEQPPAQTPLVTGLGALPLHAQPL
VGADRLSPSVHKLRQHRPLGRTQSAPLPQSAQALQQLVVQQQHQQFLEKHKQQFQQQQLH
MGKMIPKPSEPTRQPESHPEETEEELREHQALLEEPYLDRLSGQKEAHAQAGVQVKQEPL
ESDGEEAEPPRGAEPGQRQPTEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGG
HRPLSRAQSSPASATFPMSVQEPPSKPRFTTGLVYDTLMLKHQCACGNTNSHPEHAGRIQ
SIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLT
SVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHH
AEESTPMGFCYFNSVAVAAKLLQQRLNVSKTLIVDWDVHHGNGTQQAFYSDPSVLYISLH
RYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRMVVMPIANEFG
PDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRIVLALEGGHDLTAICD
ASEACVSALLGDELDPLPEKVLQQRPNANAVRSVEKVIEIHSQYWRSLQRLSSTAAYSLV
EAQKCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgggctgggaggcgtctgcaggagacacagggagacgggaggctctgtcctcc
tcagatggactttctggccgagaccagcctgtggagctgctgaaccctgcccgcgtgaac
cacatgcccagcacggtggaggtggcctcagcgctgcctttgcaggtggccccgccggcc
gtgcccatggacctgcgcctggaccaccagttcccgctgcccgtggccgagcccgccctg
cgcgagcagcagctgcagcaggagctcctggcgctgaagcagaagcagcagctgcagagg
cagctccgtgacgacaataaggacgtgaagccccgtgccacagtcctgtgtccccacagc
agcctgagcagacgggctcactccgaaaaggaggcaggtggagtgcagggtttgagcgga
gtggcggtggtcagggccagctccaacctgggcagcctggcctcagcacgggcctccagc
cacgcgccagagctccgccccgaaggccgcctggaagcccacgtggccaacgagggaggc
gtgggaagtgcctgcctgcttccaatatccctgcggtccccccgctcgtgtgtggccgga
ccggccagccagagctggaggccgcagacggatgctcgctgcctggccccgtgtctgcag
gctcggccatcaggacactgccaggcagcggggctggaggcggagcagcaccaggcgggc
cggccaggccacggagcaggcgcagcccgggcagccctgggccggcgagttctcagcccc
tggagcgagctgagggctgacagcagtgagcaccagcaggagctgctggccatgaagcac
cagcaggagctgctagagcatcagcagaagctggagcggcaccgccaggagcaggagctg
gagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaaaggcaaagag
agtgccgtggccagcacagaagtgaagatgaagttgcaggagtttgtcctgaacaaaaag
aaggcgctggcgcaccggagcctgaaccactgcatctccagcgacccccgctactggtac
gggaaaacacagcacagctccctggaccagagctccccgccccagagcggggtgtcggct
tcctacaaccacccgatcctgggcatgtacgacgccaaagatgacttccctctcagaaag
acagcttctgaacccaacctgaaattacggtctcggctaaagcagaaagtggctgagaga
cggagcagccccctgctgcgcaggaaagacgggccggtggtcaccgctctgaagaagcgt
ccgttggatgtcacagactcagcctgcagcagcgccccgggctctgcgcccagctcaccc
aacaacagctccgggagcgtcagcgcggagaacgggatcacgcccgccatccccagcctc
caggccgaggccagcttggcgcaccgactagtggcccgagagggctccatggccccgctc
cccctctacacgtcaccatccttgcccaacatcacgctgggactgcccgccaccggccct
tctgctggggcggccggccagcaggacgccgagagacttgccctcccgggcctccagcag
cgcatctccctgttccctggctcccacctggctccctacctgagcacggcgcccctcgag
cgggacggcgggacggcccacagctctctgctgcagcacgtggtcttgttggagcagccg
cctgcacagacgcccctcgtcacaggcctgggggcgctgcccctgcacgcgcagcccctg
gtgggcgcagaccggctgtccccatctgtgcacaagctgcggcagcaccgcccgctggga
cgcacgcagtcggcgcccctgcctcagagcgcgcaggccctgcagcagctggtggttcag
cagcagcaccagcagttcctggagaagcacaagcagcagttccagcagcagcagctgcac
atgggcaagatgatccccaagccgagcgagcccacccggcagcccgagagccaccccgag
gagacagaggaggagctccgcgagcaccaggccctcctggaggagccctacctggaccgg
ctgtcggggcagaaggaggcgcatgcgcaagccggcgtgcaggtgaagcaagagcccctg
gagagtgacggcgaggaggcggagccgccgcggggggcggagcccgggcagcgccagccc
accgagcaggagctgctcttcagacagcaagcgctcctcctggaacagcagcggatccac
cagctgaggaactaccaggcctccatggaggccgccggcatccccgtgtccttcggcggc
caccggcctctgtcccgggcacagtcctctcccgcctcggccaccttccccatgtctgtg
caggagccgcccagcaaaccgaggttcaccacaggcctggtatacgacacgctcatgttg
aagcaccagtgcgcctgcgggaacaccaacagccacccggagcacgccggcaggatccag
agcatctggtcccggctgcaggagaccggcctgcgcggcaaatgcgagtgtatccgcgga
cggaaggccaccctggaggagctgcagaccgtgcactcagaggcacacaccctgctctac
ggcacgaaccccctcaacaggcagaaactggacagtaagaaacttctaggctcgctgacg
tccgtgtttgtcaggctgccctgtggtggtgtcggggtggacagcgacaccatctggaac
gaggtgcactcgtccggggcggcgcgcctggccgtgggctgcgtggtggagctcgtcttc
aaggtcgccaccggggagctgaagaacggctttgctgtggtccgccctcctggacaccac
gcggaggagagcacgcccatgggcttctgctacttcaactccgtggccgtcgccgccaag
ctcctacagcagaggctgaacgtgagcaagacgctgatcgtggactgggatgtgcaccac
ggaaacgggacccagcaggccttctacagcgacccaagcgtcctgtacatctcgctgcac
cgctatgacgacgggaacttcttcccgggcagcggggcgcctgacgaggtgggcacaggg
ccgggcgtgggcttcaacgtgaacatggctttcaccggtggcctcgacccccccatggga
gacgctgagtacttggcagccttcagaatggtcgtcatgccgattgcaaacgagtttggc
ccggatgtggtgctggtgtcgtcaggctttgacgccgtggagggccaccccacgccgctg
ggcggctacaacctctccgccaaatgtttcgggtacctgacgaagcagctgatgggcttg
gcaggcggacggattgttctggccctggagggcggccacgacctcacggccatttgcgac
gcctcagaagcatgtgtttctgctttgctgggagacgagcttgatcctctcccagaaaag
gttttacagcagagacccaatgcgaacgccgtacggtccgtggagaaggtcattgaaatc
cacagtcagtactggcgctccctgcagcgtctgtcctccacggcggcctactcgctggtc
gaggcccagaagtgcgagaacgaagaagctgagactgtcacagccatggcctcactgtcc
gtgggcgtgaagccggccgagaagaggcccgacgaggagccgatggaggaggagccgccc
ctgtag

DBGET integrated database retrieval system