KEGG   Hipposideros armiger (great roundleaf bat): 109374086
Entry
109374086         CDS       T04661                                 

Definition
(RefSeq) ADP/ATP translocase 2
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04020  Calcium signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04217  Necroptosis
hai04218  Cellular senescence
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05016  Huntington disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109374086
   04022 cGMP-PKG signaling pathway
    109374086
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109374086
   04218 Cellular senescence
    109374086
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109374086
   05012 Parkinson disease
    109374086
   05016 Huntington disease
    109374086
   05017 Spinocerebellar ataxia
    109374086
   05020 Prion disease
    109374086
   05022 Pathways of neurodegeneration - multiple diseases
    109374086
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109374086
   05164 Influenza A
    109374086
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hai03029]
    109374086
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hai02000]
    109374086
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109374086
Transporters [BR:hai02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   109374086
SSDB
Motif
Pfam: Mito_carr Fuseless
Other DBs
NCBI-GeneID: 109374086
NCBI-ProteinID: XP_019483928
LinkDB
Position
Un
AA seq 298 aa
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGYLANVIRYFPTQALNFAFKDKYKQIFLGDVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKISKSDGIKGLYQGFNVS
VQGIIIYRAAYFSIYDTAKGMLPDPKNTHIFVSWMIAQSVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKFT
NT seq 897 nt   +upstreamnt  +downstreamnt
atgacagatgctgctgtgtccttcgccaaggacttcctggcaggaggagtggccgcggcc
atctccaagacggcggtagcgcccatcgaacgggtcaaactgctgctgcaagtgcagcat
gccagcaagcaaatcaccgcagataagcaatacaagggcattatagactgcgtggttcgt
atccccaaggagcagggagtcctgtccttctggcgtggttacctggccaatgtcatcaga
tacttccccacccaggctctcaactttgccttcaaagataaatacaagcagatcttcctg
ggtgatgtggacaagagaacccagttctggcgctactttgcagggaatctggcatcaggt
ggtgctgctggggccacctccttgtgttttgtgtatcctcttgattttgcccgtacccgt
ctagcagctgatgtgggcaaagctggagctgaaagggaattcaaaggcctcggtgactgc
ctggttaagatctccaaatctgatgggattaagggcctgtaccaaggcttcaatgtgtct
gtgcagggcataatcatctaccgagctgcctacttcagtatctatgacactgcaaagggc
atgcttccagatcccaagaatactcacatctttgtcagctggatgattgcacagtctgtc
acggcggtggctgggttgacttcctacccgtttgatactgtgcgtcgccgcatgatgatg
cagtcagggcgcaaaggaactgatatcatgtacacaggcacgctggactgctggaggaag
attgctcgtgatgaaggaggcaaagcttttttcaagggtgcatggtccaatgttctcaga
ggcatgggtggtgcttttgtgcttgtcttgtatgatgaaatcaagaagttcacataa

KEGG   Hipposideros armiger (great roundleaf bat): 109375563
Entry
109375563         CDS       T04661                                 

Gene name
SLC25A6
Definition
(RefSeq) solute carrier family 25 member 6
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04020  Calcium signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04217  Necroptosis
hai04218  Cellular senescence
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05016  Huntington disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109375563 (SLC25A6)
   04022 cGMP-PKG signaling pathway
    109375563 (SLC25A6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109375563 (SLC25A6)
   04218 Cellular senescence
    109375563 (SLC25A6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109375563 (SLC25A6)
   05012 Parkinson disease
    109375563 (SLC25A6)
   05016 Huntington disease
    109375563 (SLC25A6)
   05017 Spinocerebellar ataxia
    109375563 (SLC25A6)
   05020 Prion disease
    109375563 (SLC25A6)
   05022 Pathways of neurodegeneration - multiple diseases
    109375563 (SLC25A6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109375563 (SLC25A6)
   05164 Influenza A
    109375563 (SLC25A6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hai03029]
    109375563 (SLC25A6)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hai02000]
    109375563 (SLC25A6)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109375563 (SLC25A6)
Transporters [BR:hai02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   109375563 (SLC25A6)
SSDB
Motif
Pfam: Mito_carr Fuseless
Other DBs
NCBI-GeneID: 109375563
NCBI-ProteinID: XP_019486548
LinkDB
Position
Un
AA seq 164 aa
HAPERSSNGGXGKSGTEREFKGLGDCLVKITKSDGLRGLYQGFNVSVQGIIIYRAAYFGV
YDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYRGT
VDCWRKILKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI
NT seq 495 nt   +upstreamnt  +downstreamnt
cacgcccccgaacgcagcagcaacggggggntgggcaaatcgggcaccgagcgggagttc
aagggcctgggggactgtctggtgaagatcaccaagtccgacggcctgcggggcctctac
cagggcttcaacgtgtccgtgcagggcatcatcatctaccgggccgcctacttcggcgtg
tacgacacggccaaaggaatgctccctgaccccaagaacacccacatcgtggtgagctgg
atgatcgcccagacggtgacggccgtggccggcgtggtgtcctaccccttcgacaccgtc
aggcgacgcatgatgatgcagtcggggcgcaaaggagcggacatcatgtaccgggggacc
gtggactgctggcggaagatcctcaaggacgagggcggcaaggccttcttcaagggcgcc
tggtccaacgtgctgaggggcatgggcggcgccttcgtgctcgtcctctacgacgagctg
aagaaggtcatctag

KEGG   Hipposideros armiger (great roundleaf bat): 109390884
Entry
109390884         CDS       T04661                                 

Definition
(RefSeq) ADP/ATP translocase 3-like
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04020  Calcium signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04217  Necroptosis
hai04218  Cellular senescence
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05016  Huntington disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109390884
   04022 cGMP-PKG signaling pathway
    109390884
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109390884
   04218 Cellular senescence
    109390884
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109390884
   05012 Parkinson disease
    109390884
   05016 Huntington disease
    109390884
   05017 Spinocerebellar ataxia
    109390884
   05020 Prion disease
    109390884
   05022 Pathways of neurodegeneration - multiple diseases
    109390884
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109390884
   05164 Influenza A
    109390884
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hai03029]
    109390884
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hai02000]
    109390884
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109390884
Transporters [BR:hai02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   109390884
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 109390884
NCBI-ProteinID: XP_019513454
LinkDB
Position
Un
AA seq 302 aa
MMEQAISFTKDFLAGGIAIAISKMAMASIEQIKLLLQVQHASKQIAADKQYKGLVECIMG
IPKEKGVLSFWRGNQANVICYFAMQALNFAFKGKCKQVFLGWGWGCVDKHTQFWRYFVGI
VASGGVAGATSLCFIYLVDFARTRLVANVEKLGTKWEYKSLGDCLVMITKSDGLWALYQC
FNLSLLGIIIYWATYFGMYYTAKGMPPDPKNTHIVVSWTIVQVVIAMAGIVSYPFDTVRQ
HMMTQLGHKRVDIRYQGTMDCRWKIFKDKGGKAFFKSAWSNILRGMGSFLVLVLYNELKK
VI
NT seq 909 nt   +upstreamnt  +downstreamnt
atgatggaacaggccatctccttcaccaaggacttcctggccggaggcatcgccattgcc
atttccaagatggccatggcctcaattgagcagatcaagctgctgctgcaggtgcaacat
gccagcaagcagattgcagctgacaagcagtacaagggcttggtggaatgcatcatgggt
atccccaaggagaagggtgtgctgtccttctggaggggcaaccaggccaatgtcatctgt
tactttgccatgcaagctctcaactttgccttcaagggtaagtgcaagcaggtcttcctg
gggtgggggtgggggtgtgtggacaagcacacacagttctggaggtattttgttggcatc
gtggcatctggtggtgtggcaggagccacctcactctgcttcatctaccttgtggatttt
gccagaacacgtctggtggctaatgtggagaaattgggcaccaagtgggagtataagagc
ctgggggactgtctggtgatgatcactaagtccgatggcctctgggccctgtaccagtgc
ttcaacctgtccttgctgggtataatcatctattgggccacctactttggcatgtattac
actgccaaaggcatgcccccagaccctaagaacacccacattgtggtgagctggacgatt
gtccaggtggtgattgccatggctggcatagtgtcttacccctttgacaccgttaggcag
cacatgatgacgcagttggggcacaaaagagtggacatcaggtaccaagggaccatggac
tgcaggtggaagatcttcaaggacaagggtggcaaagccttcttcaaaagcgcctggtcc
aacatcctcaggggcatgggcagctttttagtactggttctgtacaacgagctgaagaag
gtcatctag

KEGG   Hipposideros armiger (great roundleaf bat): 109394950
Entry
109394950         CDS       T04661                                 

Gene name
SLC25A31
Definition
(RefSeq) solute carrier family 25 member 31
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04020  Calcium signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04217  Necroptosis
hai04218  Cellular senescence
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05016  Huntington disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109394950 (SLC25A31)
   04022 cGMP-PKG signaling pathway
    109394950 (SLC25A31)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109394950 (SLC25A31)
   04218 Cellular senescence
    109394950 (SLC25A31)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109394950 (SLC25A31)
   05012 Parkinson disease
    109394950 (SLC25A31)
   05016 Huntington disease
    109394950 (SLC25A31)
   05017 Spinocerebellar ataxia
    109394950 (SLC25A31)
   05020 Prion disease
    109394950 (SLC25A31)
   05022 Pathways of neurodegeneration - multiple diseases
    109394950 (SLC25A31)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109394950 (SLC25A31)
   05164 Influenza A
    109394950 (SLC25A31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hai03029]
    109394950 (SLC25A31)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hai02000]
    109394950 (SLC25A31)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109394950 (SLC25A31)
Transporters [BR:hai02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   109394950 (SLC25A31)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 109394950
NCBI-ProteinID: XP_019521122
LinkDB
Position
Un
AA seq 320 aa
MQRDPPKKPEKEGKRLFDVASFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQIS
PEAQYKGMVDCLVRIPREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKE
KQFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGADIGKGPEERQFKGLGDCIMKIAK
SDGIIGLYQGFGVSVQGIIVYRASYFGVYDTVKGLLPKPKETPFVVSFFIAQVVTTCSGI
LSYPFDTVRRRMMMQSGEAERQYKGTLDCFVKIYQHEGVNAFFRGAFSNVLRGTGGALVL
VLYDKIKEFLNINVGGSSSD
NT seq 963 nt   +upstreamnt  +downstreamnt
atgcagcgtgaccctccgaagaagccggagaaggagggcaagcggctctttgacgtcgcg
tccttcgggaaggacctgctggcaggcggggtcgcggcggctgtgtccaagaccgcggtg
gcgcccatcgagcgggtgaagctgctgctgcaggtgcaggcgtcgtccaagcagataagc
cctgaggcgcagtacaaaggcatggtggactgtctggtgcggattccccgcgagcagggt
ttcttcagtttttggcgtggtaatttggcaaatgttatccggtattttccaacacaagct
ctaaattttgcttttaaggacaaatataaacaacttttcatgtctggagttaataaagaa
aaacagttctggaggtggtttttggcaaacctggcttctggaggagcagctggggcaaca
tccttatgtgtggtatatccactagattttgcccgaaccagattaggtgctgatattgga
aaaggtcccgaagaacgacaattcaaggggttaggtgactgtattatgaaaatagcaaaa
tcagatggaattattggtttataccaagggtttggtgtttcagtacagggcatcattgtg
taccgagcctcttattttggagtttatgacacagttaagggcttactaccaaaaccaaag
gaaaccccattcgttgtctcctttttcattgctcaagttgtgactacatgctctggaatc
ctttcttacccctttgacacagttagaagacgtatgatgatgcagagtggtgaagctgaa
cggcaatataaaggaactttagactgctttgtgaagatataccaacatgagggagtcaat
gcattttttcgtggcgcgttctccaatgtccttcgtggtacagggggtgctttagttttg
gtattgtatgataaaattaaagaattccttaatattaatgttggaggtagttcatcagat
taa

KEGG   Hipposideros armiger (great roundleaf bat): 109395862
Entry
109395862         CDS       T04661                                 

Gene name
SLC25A4
Definition
(RefSeq) solute carrier family 25 member 4
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04020  Calcium signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04217  Necroptosis
hai04218  Cellular senescence
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05016  Huntington disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109395862 (SLC25A4)
   04022 cGMP-PKG signaling pathway
    109395862 (SLC25A4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109395862 (SLC25A4)
   04218 Cellular senescence
    109395862 (SLC25A4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109395862 (SLC25A4)
   05012 Parkinson disease
    109395862 (SLC25A4)
   05016 Huntington disease
    109395862 (SLC25A4)
   05017 Spinocerebellar ataxia
    109395862 (SLC25A4)
   05020 Prion disease
    109395862 (SLC25A4)
   05022 Pathways of neurodegeneration - multiple diseases
    109395862 (SLC25A4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109395862 (SLC25A4)
   05164 Influenza A
    109395862 (SLC25A4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hai03029]
    109395862 (SLC25A4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hai02000]
    109395862 (SLC25A4)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109395862 (SLC25A4)
Transporters [BR:hai02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   109395862 (SLC25A4)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 109395862
NCBI-ProteinID: XP_019522791
LinkDB
Position
Un
AA seq 298 aa
MSDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIMDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFNGLGDCLTKIFKSDGLKGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTLDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt   +upstreamnt  +downstreamnt
atgagtgatcaggctttgagcttcttgaaggacttcctggcaggcggcatcgccgctgcc
gtctccaagaccgcggtcgcccccatcgagagggtcaaattgctgctgcaggtccagcat
gccagcaaacagatcagtgctgagaagcagtacaaggggatcatggattgtgtggtgaga
atccccaaggagcagggctttctctccttctggaggggaaacctggccaatgtcatccgt
tacttccccacccaagctctcaacttcgccttcaaggacaagtacaagcagatcttcctg
gggggcgtggaccggcataagcagttctggcgctactttgctggtaacctggcttccggt
ggggcagctggggccacctccctctgctttgtctacccgctggactttgccaggaccagg
ttggctgctgacgtgggcaagggtgccgcccagcgtgagttcaatggtctgggtgactgt
ctcaccaagatcttcaagtctgatggcctgaagggtctctaccagggtttcagcgtctct
gtccagggcatcattatctacagagctgcctacttcggagtctatgacactgccaagggg
atgctgcctgatcccaagaatgtgcacattttcgtcagctggatgattgcccagagcgtg
acggcggtcgcggggctggtgtcctacccctttgacactgtccgccgtaggatgatgatg
cagtctggccggaaaggggcggatattatgtacactgggacactggactgctggaggaag
attgccaaagatgaaggagccaaagctttcttcaaaggtgcctggtccaatgtattgaga
ggcatgggcggtgcttttgtattggtgttgtatgatgagataaaaaaatatgtctaa

DBGET integrated database retrieval system