KEGG   Hipposideros armiger (great roundleaf bat): 109374090
Entry
109374090         CDS       T04661                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04064  NF-kappa B signaling pathway
hai04068  FoxO signaling pathway
hai04110  Cell cycle
hai04115  p53 signaling pathway
hai04210  Apoptosis
hai04218  Cellular senescence
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109374090 (GADD45G)
   04064 NF-kappa B signaling pathway
    109374090 (GADD45G)
   04068 FoxO signaling pathway
    109374090 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109374090 (GADD45G)
   04210 Apoptosis
    109374090 (GADD45G)
   04115 p53 signaling pathway
    109374090 (GADD45G)
   04218 Cellular senescence
    109374090 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109374090 (GADD45G)
   05202 Transcriptional misregulation in cancer
    109374090 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109374090 (GADD45G)
   05212 Pancreatic cancer
    109374090 (GADD45G)
   05225 Hepatocellular carcinoma
    109374090 (GADD45G)
   05226 Gastric cancer
    109374090 (GADD45G)
   05214 Glioma
    109374090 (GADD45G)
   05216 Thyroid cancer
    109374090 (GADD45G)
   05220 Chronic myeloid leukemia
    109374090 (GADD45G)
   05217 Basal cell carcinoma
    109374090 (GADD45G)
   05218 Melanoma
    109374090 (GADD45G)
   05213 Endometrial cancer
    109374090 (GADD45G)
   05224 Breast cancer
    109374090 (GADD45G)
   05222 Small cell lung cancer
    109374090 (GADD45G)
   05223 Non-small cell lung cancer
    109374090 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109374090 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109374090 (GADD45G)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109374090 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109374090 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109374090
NCBI-ProteinID: XP_019483930
LinkDB
Position
Un
AA seq 159 aa
MTLEEVRCQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEAGAPGDLHCI
LISNPNEDTWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgctgccaggacacggttcctgaaagcacagccaggatgcag
ggcgccgggaaagcgctgcacgagctgctgttatcggcgcagcgccagggctgcctcacc
gccggcgtttacgagtccgccaaagtcctgaacgtggaccccgacaacgtgaccttctgc
gtgctggcagcagatgaggaggacgagggcgatatcgcgctgcagatccacttcacgctg
atccaggcgttctgctgcgagaacgacatcgacatcgtgcgtgtgggcgacgtgcagcgg
ctggcggccatcgtgggcgcaggcgacgaggcgggcgcgccaggagacttgcattgcatc
ctcatttcgaaccccaatgaggacacgtggaaggaccccgctttggagaagctcagcctg
ttctgcgaggaaagccgcagtgtcaacgactgggtgcccagtattaccctccctgagtga

KEGG   Hipposideros armiger (great roundleaf bat): 109384926
Entry
109384926         CDS       T04661                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04064  NF-kappa B signaling pathway
hai04068  FoxO signaling pathway
hai04110  Cell cycle
hai04115  p53 signaling pathway
hai04210  Apoptosis
hai04218  Cellular senescence
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109384926 (GADD45A)
   04064 NF-kappa B signaling pathway
    109384926 (GADD45A)
   04068 FoxO signaling pathway
    109384926 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109384926 (GADD45A)
   04210 Apoptosis
    109384926 (GADD45A)
   04115 p53 signaling pathway
    109384926 (GADD45A)
   04218 Cellular senescence
    109384926 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109384926 (GADD45A)
   05202 Transcriptional misregulation in cancer
    109384926 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109384926 (GADD45A)
   05212 Pancreatic cancer
    109384926 (GADD45A)
   05225 Hepatocellular carcinoma
    109384926 (GADD45A)
   05226 Gastric cancer
    109384926 (GADD45A)
   05214 Glioma
    109384926 (GADD45A)
   05216 Thyroid cancer
    109384926 (GADD45A)
   05220 Chronic myeloid leukemia
    109384926 (GADD45A)
   05217 Basal cell carcinoma
    109384926 (GADD45A)
   05218 Melanoma
    109384926 (GADD45A)
   05213 Endometrial cancer
    109384926 (GADD45A)
   05224 Breast cancer
    109384926 (GADD45A)
   05222 Small cell lung cancer
    109384926 (GADD45A)
   05223 Non-small cell lung cancer
    109384926 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109384926 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109384926 (GADD45A)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109384926 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109384926 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109384926
NCBI-ProteinID: XP_019502237
LinkDB
Position
Un
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDASPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattttcggcaggagagcaaaagaccgaaaggatggataaggtgggg
gatgccctcgaggaagtgctgagcaaagctctgagtcagcgcaccatcacggtcggggtg
tacgaggcggccaagctgctcaacgtcgacccggataacgtagttctgtgcctgctggcc
gcggacgaggacgacgacagagatgtggctctgcagatccacttcaccctgatccaggca
ttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcctggagaccgacgcgagcccggcggcgagcgagggcgcagagcaaccccca
gacctgcactgcgtgctggtgacgaatccacattcatcgcaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatcttcctgaacggtga

KEGG   Hipposideros armiger (great roundleaf bat): 109390584
Entry
109390584         CDS       T04661                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04064  NF-kappa B signaling pathway
hai04068  FoxO signaling pathway
hai04110  Cell cycle
hai04115  p53 signaling pathway
hai04210  Apoptosis
hai04218  Cellular senescence
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109390584 (GADD45B)
   04064 NF-kappa B signaling pathway
    109390584 (GADD45B)
   04068 FoxO signaling pathway
    109390584 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109390584 (GADD45B)
   04210 Apoptosis
    109390584 (GADD45B)
   04115 p53 signaling pathway
    109390584 (GADD45B)
   04218 Cellular senescence
    109390584 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109390584 (GADD45B)
   05202 Transcriptional misregulation in cancer
    109390584 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109390584 (GADD45B)
   05212 Pancreatic cancer
    109390584 (GADD45B)
   05225 Hepatocellular carcinoma
    109390584 (GADD45B)
   05226 Gastric cancer
    109390584 (GADD45B)
   05214 Glioma
    109390584 (GADD45B)
   05216 Thyroid cancer
    109390584 (GADD45B)
   05220 Chronic myeloid leukemia
    109390584 (GADD45B)
   05217 Basal cell carcinoma
    109390584 (GADD45B)
   05218 Melanoma
    109390584 (GADD45B)
   05213 Endometrial cancer
    109390584 (GADD45B)
   05224 Breast cancer
    109390584 (GADD45B)
   05222 Small cell lung cancer
    109390584 (GADD45B)
   05223 Non-small cell lung cancer
    109390584 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109390584 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109390584 (GADD45B)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109390584 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109390584 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109390584
NCBI-ProteinID: XP_019512763
LinkDB
Position
Un
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQCQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQDTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQDR
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctggtggcgtgcgacaacgcggcgcagaagatgcagaccgtgagc
gccgcggtggaggagctgctggtggccgcgcagtgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggaccctgacagcgtggttctgtgcctcttggcc
attgatgaggaggaagaggacgacatcgccctgcagatccacttcacactcatccagtcc
ttctgctgcgataatgacatcaacatcgtgcgggtgtcaggcatgcaacgcctggcacag
ctgctgggcgagcctgccgaaacccaggacaccaccgaggctcgggacctgcactgcctc
ctggtcacgaaccctcacacagatgcctggaagagccacggcctggtggaggtagccagt
tattgtgaagagagccgggggaacaaccagtgggtcccctacatctccctccaggatcgc
tga

DBGET integrated database retrieval system