KEGG   Hipposideros armiger (great roundleaf bat): 109374176
Entry
109374176         CDS       T04661                                 

Gene name
PYCARD
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04217  Necroptosis
hai04621  NOD-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04625  C-type lectin receptor signaling pathway
hai05132  Salmonella infection
hai05133  Pertussis
hai05134  Legionellosis
hai05135  Yersinia infection
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109374176 (PYCARD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109374176 (PYCARD)
   04623 Cytosolic DNA-sensing pathway
    109374176 (PYCARD)
   04625 C-type lectin receptor signaling pathway
    109374176 (PYCARD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109374176 (PYCARD)
   05135 Yersinia infection
    109374176 (PYCARD)
   05133 Pertussis
    109374176 (PYCARD)
   05134 Legionellosis
    109374176 (PYCARD)
  09172 Infectious disease: viral
   05164 Influenza A
    109374176 (PYCARD)
SSDB
Motif
Pfam: CARD PYRIN
Other DBs
NCBI-GeneID: 109374176
NCBI-ProteinID: XP_019484064
LinkDB
Position
Un
AA seq 195 aa
MGCARDAIQEALENLTADELKRFKMKLLSVPLRDGYGRIPRGTLLSLDAMDLTDKLVSFY
LEGYGAELTATVLRDIGMKELALRLQEVMGQGAGDVPAGIQPSSQAVGMPALHFVDQHRA
ALISRVTDVDGVLDALHRRVLTEEQYQAVRAEPTNPTKMRKLFSFAPAWNAACKDLLLQA
LRDSQPYLVADLERS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggggtgcgcgcgcgacgccatccaggaggctctggagaacctgaccgctgatgagctc
aagaggttcaagatgaagctgctttcggtgccgctgcgcgacggctacgggcgcatccca
cgggggacgctgctgtccctggacgccatggacctcacagacaagctggtcagcttttac
ctggaggggtacggcgccgagctcacagcgaccgtgctgcgggacataggcatgaaggag
ctggccctgcggctgcaggaagtcatgggccagggcgctggagacgtaccagctgggatc
cagccctcttcccaggcggtaggcatgccagcgctgcacttcgtggaccagcaccgggct
gccctcatctcgcgggtcacagatgtggatggggtgctggatgccctgcacagaagggtc
ctgacggaggagcagtaccaggcagtgcgcgccgagcccaccaatcccaccaagatgagg
aagctcttcagctttgccccagcctggaatgcggcctgcaaggacctgctccttcaggcc
ctgagggacagccagccctacctggtagccgacctggagaggagctga

DBGET integrated database retrieval system