KEGG   Hipposideros armiger (great roundleaf bat): 109374670
Entry
109374670         CDS       T04661                                 

Definition
(RefSeq) interferon alpha-4-like
  KO
K05414  interferon alpha
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04151  PI3K-Akt signaling pathway
hai04217  Necroptosis
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109374670
   04151 PI3K-Akt signaling pathway
    109374670
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109374670
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109374670
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109374670
   04621 NOD-like receptor signaling pathway
    109374670
   04622 RIG-I-like receptor signaling pathway
    109374670
   04623 Cytosolic DNA-sensing pathway
    109374670
   04650 Natural killer cell mediated cytotoxicity
    109374670
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109374670
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109374670
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109374670
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109374670
   05162 Measles
    109374670
   05164 Influenza A
    109374670
   05161 Hepatitis B
    109374670
   05160 Hepatitis C
    109374670
   05168 Herpes simplex virus 1 infection
    109374670
   05163 Human cytomegalovirus infection
    109374670
   05167 Kaposi sarcoma-associated herpesvirus infection
    109374670
   05169 Epstein-Barr virus infection
    109374670
   05165 Human papillomavirus infection
    109374670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109374670
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interferons
   109374670
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 109374670
NCBI-ProteinID: XP_019484981
LinkDB
Position
Un
AA seq 123 aa
MAMMKQYKLVIHECLLAQAISVVHQMTQQTFHRFRIEGSFAAWDKTLLVNFCTGLDQQLN
DLEACVTQEVGVEETPLMNEDSILAVRKYFRRITLNLQKNYSPCAWAVVRAEIMRAFSFS
PNS
NT seq 372 nt   +upstreamnt  +downstreamnt
atggccatgatgaagcaatataaattggttattcatgaatgccttctggctcaagccatc
tctgtcgtccaccagatgacccagcagaccttccaccgcttcagaatagagggctctttt
gctgcttgggataagaccctcctagtcaacttctgcactggacttgaccagcagctgaat
gacctggaagcctgtgtgacgcaggaggtgggggtggaagagactcccctgatgaatgag
gactccattctggctgtgaggaaatacttcaggagaatcaccctcaatctgcagaagaat
tacagcccttgtgcctgggcggttgtcagggcagaaatcatgagagccttctctttctca
ccaaactcctag

DBGET integrated database retrieval system