KEGG   Hipposideros armiger (great roundleaf bat): 109374675
Entry
109374675         CDS       T04661                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A-like
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04110  Cell cycle
hai04115  p53 signaling pathway
hai04218  Cellular senescence
hai04934  Cushing syndrome
hai05163  Human cytomegalovirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05206  MicroRNAs in cancer
hai05212  Pancreatic cancer
hai05214  Glioma
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05223  Non-small cell lung cancer
hai05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109374675
   04115 p53 signaling pathway
    109374675
   04218 Cellular senescence
    109374675
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109374675
   05206 MicroRNAs in cancer
    109374675
   05203 Viral carcinogenesis
    109374675
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109374675
   05225 Hepatocellular carcinoma
    109374675
   05214 Glioma
    109374675
   05220 Chronic myeloid leukemia
    109374675
   05218 Melanoma
    109374675
   05219 Bladder cancer
    109374675
   05223 Non-small cell lung cancer
    109374675
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109374675
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109374675
   05163 Human cytomegalovirus infection
    109374675
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109374675
   01522 Endocrine resistance
    109374675
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 109374675
NCBI-ProteinID: XP_019484982
LinkDB
Position
Un
AA seq 139 aa
MEPLADRLASAAARGRVKEVQALLQEGAPPNAPNIHGRSPIQVMMMGSTRVAELLLLHGA
DPNCADPATLTRPVHDAAREGFLDTLAVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAQ
YLRMAAGGTESGSHARTDV
NT seq 420 nt   +upstreamnt  +downstreamnt
atggagcccttggctgacaggctggcctccgccgccgcccggggccgcgtgaaggaggtg
caggcgttgctccaggagggggcaccgcccaatgcgcccaacattcacggtcggagcccc
attcaggtcatgatgatgggcagcacccgagtggccgagctgctgctgctccacggcgcg
gaccccaactgcgcagaccccgccaccctcacccgcccggtgcatgatgccgcccgggaa
ggcttcctggacacgctggcggtgctgcaccgagccggggcgcggctggatgtgcgcgat
gcctggggccgcctgccagtggacctggctgaggagcggggccaccgcgatgttgcccag
tacctgcgcatggccgcagggggcaccgaaagcggtagccacgcccgtacagacgtctaa

DBGET integrated database retrieval system