KEGG   Hipposideros armiger (great roundleaf bat): 109374859
Entry
109374859         CDS       T04661                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04261  Adrenergic signaling in cardiomyocytes
hai04370  VEGF signaling pathway
hai04371  Apelin signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04728  Dopaminergic synapse
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04920  Adipocytokine signaling pathway
hai04922  Glucagon signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04973  Carbohydrate digestion and absorption
hai05010  Alzheimer disease
hai05017  Spinocerebellar ataxia
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109374859 (AKT2)
   04012 ErbB signaling pathway
    109374859 (AKT2)
   04014 Ras signaling pathway
    109374859 (AKT2)
   04015 Rap1 signaling pathway
    109374859 (AKT2)
   04370 VEGF signaling pathway
    109374859 (AKT2)
   04371 Apelin signaling pathway
    109374859 (AKT2)
   04630 JAK-STAT signaling pathway
    109374859 (AKT2)
   04668 TNF signaling pathway
    109374859 (AKT2)
   04066 HIF-1 signaling pathway
    109374859 (AKT2)
   04068 FoxO signaling pathway
    109374859 (AKT2)
   04072 Phospholipase D signaling pathway
    109374859 (AKT2)
   04071 Sphingolipid signaling pathway
    109374859 (AKT2)
   04024 cAMP signaling pathway
    109374859 (AKT2)
   04022 cGMP-PKG signaling pathway
    109374859 (AKT2)
   04151 PI3K-Akt signaling pathway
    109374859 (AKT2)
   04152 AMPK signaling pathway
    109374859 (AKT2)
   04150 mTOR signaling pathway
    109374859 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109374859 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    109374859 (AKT2)
   04218 Cellular senescence
    109374859 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109374859 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    109374859 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109374859 (AKT2)
   04620 Toll-like receptor signaling pathway
    109374859 (AKT2)
   04625 C-type lectin receptor signaling pathway
    109374859 (AKT2)
   04660 T cell receptor signaling pathway
    109374859 (AKT2)
   04662 B cell receptor signaling pathway
    109374859 (AKT2)
   04664 Fc epsilon RI signaling pathway
    109374859 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    109374859 (AKT2)
   04062 Chemokine signaling pathway
    109374859 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109374859 (AKT2)
   04922 Glucagon signaling pathway
    109374859 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    109374859 (AKT2)
   04920 Adipocytokine signaling pathway
    109374859 (AKT2)
   04929 GnRH secretion
    109374859 (AKT2)
   04915 Estrogen signaling pathway
    109374859 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    109374859 (AKT2)
   04917 Prolactin signaling pathway
    109374859 (AKT2)
   04926 Relaxin signaling pathway
    109374859 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    109374859 (AKT2)
   04919 Thyroid hormone signaling pathway
    109374859 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109374859 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109374859 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    109374859 (AKT2)
   04728 Dopaminergic synapse
    109374859 (AKT2)
   04722 Neurotrophin signaling pathway
    109374859 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109374859 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    109374859 (AKT2)
   04213 Longevity regulating pathway - multiple species
    109374859 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109374859 (AKT2)
   05205 Proteoglycans in cancer
    109374859 (AKT2)
   05230 Central carbon metabolism in cancer
    109374859 (AKT2)
   05231 Choline metabolism in cancer
    109374859 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109374859 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109374859 (AKT2)
   05212 Pancreatic cancer
    109374859 (AKT2)
   05225 Hepatocellular carcinoma
    109374859 (AKT2)
   05226 Gastric cancer
    109374859 (AKT2)
   05214 Glioma
    109374859 (AKT2)
   05221 Acute myeloid leukemia
    109374859 (AKT2)
   05220 Chronic myeloid leukemia
    109374859 (AKT2)
   05218 Melanoma
    109374859 (AKT2)
   05211 Renal cell carcinoma
    109374859 (AKT2)
   05215 Prostate cancer
    109374859 (AKT2)
   05213 Endometrial cancer
    109374859 (AKT2)
   05224 Breast cancer
    109374859 (AKT2)
   05222 Small cell lung cancer
    109374859 (AKT2)
   05223 Non-small cell lung cancer
    109374859 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109374859 (AKT2)
   05017 Spinocerebellar ataxia
    109374859 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109374859 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109374859 (AKT2)
   04931 Insulin resistance
    109374859 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109374859 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109374859 (AKT2)
   05135 Yersinia infection
    109374859 (AKT2)
   05152 Tuberculosis
    109374859 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109374859 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    109374859 (AKT2)
   05162 Measles
    109374859 (AKT2)
   05164 Influenza A
    109374859 (AKT2)
   05161 Hepatitis B
    109374859 (AKT2)
   05160 Hepatitis C
    109374859 (AKT2)
   05168 Herpes simplex virus 1 infection
    109374859 (AKT2)
   05163 Human cytomegalovirus infection
    109374859 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109374859 (AKT2)
   05169 Epstein-Barr virus infection
    109374859 (AKT2)
   05165 Human papillomavirus infection
    109374859 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109374859 (AKT2)
   05142 Chagas disease
    109374859 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109374859 (AKT2)
   01524 Platinum drug resistance
    109374859 (AKT2)
   01522 Endocrine resistance
    109374859 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109374859 (AKT2)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109374859 (AKT2)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109374859 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 109374859
NCBI-ProteinID: XP_019485326
LinkDB
Position
Un
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGDDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKALLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLDMDQPTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaatacataaag
acctggaggccccggtacttcctgctgaagagtgatggctccttcattggatataaggaa
cggcccgaggcccctgaccagaccctgccccccctaaacaacttctccgttgcagaatgc
cagctgatgaagaccgagagaccgaggcccaacacctttgtcatacgctgcctgcagtgg
accacagtcattgagaggaccttccatgtagactctccagatgagagggaggagtggatg
cgggctatccagatggtcgccaacagcctcaagcagcggggcccaggtgatgaccccatg
gactacaagtgtggctcccctagtgactcttccgcagctgaggagatggaagtggcagtt
agcaaggcccgggccaaggtgactatgaatgacttcgactatctcaaactcctcggcaag
ggcacctttggcaaagtgatcctggtgcgggagaaggccactggccgctactacgccatg
aagatcctgcggaaggaggttatcatcgccaaggatgaagttgcccacaccgtcaccgag
agccgagtccttcagaacaccaggcacccattcctcactgccctgaaatatgccttccag
acccacgaccgcctgtgctttgtgatggagtacgccaacggtggtgagctgttcttccac
ctgtcccgggaacgtgtcttcacggaggagcgggcccgcttttatggcgcagagatcgtt
tcagccctggagtacttgcattcacgggacgtggtgtaccgtgacatcaagctggaaaat
ctcatgctggacaaagatggccacatcaagatcacagactttggcctgtgcaaagagggc
atcagtgatggggccaccatgagaaccttctgcggaacccccgaatacctggcacctgag
gtgctggaggacaatgactacggccgggcggtggactggtgggggctgggcgtggtcatg
tatgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacactcagccctgaggccaaggccctt
cttgccgggctgcttaagaaggaccccaagcaaaggctcggcggggggcccagcgatgcc
aaggaggtcatggagcacaggttctttctcagcatcaactggcaggacgtggtacagaag
aagctcctgccacccttcaaacctcaggtcacatctgaggtcgacacaaggtacttcgat
gatgagttcaccgcccagtccatcacaatcacgcccccggaccgctatgacagcctgggc
tcgctcgacatggaccagccgacccacttcccccagttctcctactcggccagcatccgc
gagtga

KEGG   Hipposideros armiger (great roundleaf bat): 109381083
Entry
109381083         CDS       T04661                                 

Gene name
AKT1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04261  Adrenergic signaling in cardiomyocytes
hai04370  VEGF signaling pathway
hai04371  Apelin signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04728  Dopaminergic synapse
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04920  Adipocytokine signaling pathway
hai04922  Glucagon signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04973  Carbohydrate digestion and absorption
hai05010  Alzheimer disease
hai05017  Spinocerebellar ataxia
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109381083 (AKT1)
   04012 ErbB signaling pathway
    109381083 (AKT1)
   04014 Ras signaling pathway
    109381083 (AKT1)
   04015 Rap1 signaling pathway
    109381083 (AKT1)
   04370 VEGF signaling pathway
    109381083 (AKT1)
   04371 Apelin signaling pathway
    109381083 (AKT1)
   04630 JAK-STAT signaling pathway
    109381083 (AKT1)
   04668 TNF signaling pathway
    109381083 (AKT1)
   04066 HIF-1 signaling pathway
    109381083 (AKT1)
   04068 FoxO signaling pathway
    109381083 (AKT1)
   04072 Phospholipase D signaling pathway
    109381083 (AKT1)
   04071 Sphingolipid signaling pathway
    109381083 (AKT1)
   04024 cAMP signaling pathway
    109381083 (AKT1)
   04022 cGMP-PKG signaling pathway
    109381083 (AKT1)
   04151 PI3K-Akt signaling pathway
    109381083 (AKT1)
   04152 AMPK signaling pathway
    109381083 (AKT1)
   04150 mTOR signaling pathway
    109381083 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109381083 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    109381083 (AKT1)
   04218 Cellular senescence
    109381083 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109381083 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    109381083 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109381083 (AKT1)
   04620 Toll-like receptor signaling pathway
    109381083 (AKT1)
   04625 C-type lectin receptor signaling pathway
    109381083 (AKT1)
   04660 T cell receptor signaling pathway
    109381083 (AKT1)
   04662 B cell receptor signaling pathway
    109381083 (AKT1)
   04664 Fc epsilon RI signaling pathway
    109381083 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    109381083 (AKT1)
   04062 Chemokine signaling pathway
    109381083 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109381083 (AKT1)
   04922 Glucagon signaling pathway
    109381083 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    109381083 (AKT1)
   04920 Adipocytokine signaling pathway
    109381083 (AKT1)
   04929 GnRH secretion
    109381083 (AKT1)
   04915 Estrogen signaling pathway
    109381083 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    109381083 (AKT1)
   04917 Prolactin signaling pathway
    109381083 (AKT1)
   04926 Relaxin signaling pathway
    109381083 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    109381083 (AKT1)
   04919 Thyroid hormone signaling pathway
    109381083 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109381083 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109381083 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    109381083 (AKT1)
   04728 Dopaminergic synapse
    109381083 (AKT1)
   04722 Neurotrophin signaling pathway
    109381083 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109381083 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    109381083 (AKT1)
   04213 Longevity regulating pathway - multiple species
    109381083 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381083 (AKT1)
   05205 Proteoglycans in cancer
    109381083 (AKT1)
   05230 Central carbon metabolism in cancer
    109381083 (AKT1)
   05231 Choline metabolism in cancer
    109381083 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109381083 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109381083 (AKT1)
   05212 Pancreatic cancer
    109381083 (AKT1)
   05225 Hepatocellular carcinoma
    109381083 (AKT1)
   05226 Gastric cancer
    109381083 (AKT1)
   05214 Glioma
    109381083 (AKT1)
   05221 Acute myeloid leukemia
    109381083 (AKT1)
   05220 Chronic myeloid leukemia
    109381083 (AKT1)
   05218 Melanoma
    109381083 (AKT1)
   05211 Renal cell carcinoma
    109381083 (AKT1)
   05215 Prostate cancer
    109381083 (AKT1)
   05213 Endometrial cancer
    109381083 (AKT1)
   05224 Breast cancer
    109381083 (AKT1)
   05222 Small cell lung cancer
    109381083 (AKT1)
   05223 Non-small cell lung cancer
    109381083 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109381083 (AKT1)
   05017 Spinocerebellar ataxia
    109381083 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109381083 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109381083 (AKT1)
   04931 Insulin resistance
    109381083 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109381083 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109381083 (AKT1)
   05135 Yersinia infection
    109381083 (AKT1)
   05152 Tuberculosis
    109381083 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109381083 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    109381083 (AKT1)
   05162 Measles
    109381083 (AKT1)
   05164 Influenza A
    109381083 (AKT1)
   05161 Hepatitis B
    109381083 (AKT1)
   05160 Hepatitis C
    109381083 (AKT1)
   05168 Herpes simplex virus 1 infection
    109381083 (AKT1)
   05163 Human cytomegalovirus infection
    109381083 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109381083 (AKT1)
   05169 Epstein-Barr virus infection
    109381083 (AKT1)
   05165 Human papillomavirus infection
    109381083 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109381083 (AKT1)
   05142 Chagas disease
    109381083 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109381083 (AKT1)
   01524 Platinum drug resistance
    109381083 (AKT1)
   01522 Endocrine resistance
    109381083 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109381083 (AKT1)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109381083 (AKT1)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109381083 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 109381083
NCBI-ProteinID: XP_019494949
LinkDB
Position
Un
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHEKLFEL
ILMEEIRFPRSLSPEAKALLSGLLKKDPRQRLGGGPEDAKEIMQHRFFASIVWQDVYEKK
LCPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaagagggctggctgcacaaacgaggggagtacatcaaa
acctggcggccccggtacttcctgctgaagaacgatggcaccttcattgggtacaaggag
cggccgcaggacgtggagcagcgcgagtcgcccctcaacaacttctcagtggcgcaatgc
cagctgatgaagacggaacggccccggcccaacaccttcatcatccgctgcctgcagtgg
accacggtcatcgagcgcaccttccacgtggagacccccgaggaacgggaggagtggacg
accgccatccagacggtggccgacgggctcaagaagcaggaggaggagatgatggacttc
cggtcaggctcgcccagtgacaactcgggggccgaggagatggaggtgtccctggctaag
cccaagcaccgcgtgaccatgaatgagtttgagtacctgaagctgctgggcaaaggcacc
ttcgggaaggtgatcctggtgaaggagaaggccacaggccgctactacgctatgaagatc
ctcaagaaggaggtcattgtggccaaggacgaggtggctcacacgctcacagagaaccgc
gtcctccagaactcccggcaccccttcctgacggccctgaagtactccttccagacccac
gaccgcctctgcttcgtcatggagtacgccaacggcggcgagctcttcttccacctgtcg
cgggagcgggtgttccctgaggaccgggcgcgcttctacggggcggagatcgtgtcggcc
ctagactacttgcactcggagaagaacgtggtctaccgtgacctcaagctggagaacctc
atgctggacaaggatggacacatcaagatcaccgacttcgggctctgcaaggagggcatc
aaggacggtgccaccatgaagaccttctgcgggacccccgagtacctggcccccgaggtg
ctggaggacaacgactacggccgcgcggtggactggtggggactgggcgtggtcatgtac
gagatgctgtgcggccggctgcccttctacaaccaggaccacgagaagctgtttgagctc
atcctcatggaggagatacgcttcccgcgctcgctcagccctgaggccaaggccctgctg
tcagggctgctcaagaaggaccccaggcagcgtcttggagggggccccgaggacgccaag
gagatcatgcagcaccgcttcttcgccagcattgtgtggcaggacgtgtacgagaagaag
ctctgtccgcccttcaagccccaggttacgtcagagacagacaccaggtattttgacgag
gagttcaccgcccagatgatcaccatcacgccacctgaccaagacgacaacatggagtgc
gtggacagtgagcggaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Hipposideros armiger (great roundleaf bat): 109385353
Entry
109385353         CDS       T04661                                 

Gene name
AKT3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04261  Adrenergic signaling in cardiomyocytes
hai04370  VEGF signaling pathway
hai04371  Apelin signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04728  Dopaminergic synapse
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04920  Adipocytokine signaling pathway
hai04922  Glucagon signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04973  Carbohydrate digestion and absorption
hai05010  Alzheimer disease
hai05017  Spinocerebellar ataxia
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109385353 (AKT3)
   04012 ErbB signaling pathway
    109385353 (AKT3)
   04014 Ras signaling pathway
    109385353 (AKT3)
   04015 Rap1 signaling pathway
    109385353 (AKT3)
   04370 VEGF signaling pathway
    109385353 (AKT3)
   04371 Apelin signaling pathway
    109385353 (AKT3)
   04630 JAK-STAT signaling pathway
    109385353 (AKT3)
   04668 TNF signaling pathway
    109385353 (AKT3)
   04066 HIF-1 signaling pathway
    109385353 (AKT3)
   04068 FoxO signaling pathway
    109385353 (AKT3)
   04072 Phospholipase D signaling pathway
    109385353 (AKT3)
   04071 Sphingolipid signaling pathway
    109385353 (AKT3)
   04024 cAMP signaling pathway
    109385353 (AKT3)
   04022 cGMP-PKG signaling pathway
    109385353 (AKT3)
   04151 PI3K-Akt signaling pathway
    109385353 (AKT3)
   04152 AMPK signaling pathway
    109385353 (AKT3)
   04150 mTOR signaling pathway
    109385353 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109385353 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    109385353 (AKT3)
   04218 Cellular senescence
    109385353 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109385353 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    109385353 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109385353 (AKT3)
   04620 Toll-like receptor signaling pathway
    109385353 (AKT3)
   04625 C-type lectin receptor signaling pathway
    109385353 (AKT3)
   04660 T cell receptor signaling pathway
    109385353 (AKT3)
   04662 B cell receptor signaling pathway
    109385353 (AKT3)
   04664 Fc epsilon RI signaling pathway
    109385353 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    109385353 (AKT3)
   04062 Chemokine signaling pathway
    109385353 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109385353 (AKT3)
   04922 Glucagon signaling pathway
    109385353 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    109385353 (AKT3)
   04920 Adipocytokine signaling pathway
    109385353 (AKT3)
   04929 GnRH secretion
    109385353 (AKT3)
   04915 Estrogen signaling pathway
    109385353 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    109385353 (AKT3)
   04917 Prolactin signaling pathway
    109385353 (AKT3)
   04926 Relaxin signaling pathway
    109385353 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    109385353 (AKT3)
   04919 Thyroid hormone signaling pathway
    109385353 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109385353 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109385353 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    109385353 (AKT3)
   04728 Dopaminergic synapse
    109385353 (AKT3)
   04722 Neurotrophin signaling pathway
    109385353 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109385353 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    109385353 (AKT3)
   04213 Longevity regulating pathway - multiple species
    109385353 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385353 (AKT3)
   05205 Proteoglycans in cancer
    109385353 (AKT3)
   05230 Central carbon metabolism in cancer
    109385353 (AKT3)
   05231 Choline metabolism in cancer
    109385353 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109385353 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109385353 (AKT3)
   05212 Pancreatic cancer
    109385353 (AKT3)
   05225 Hepatocellular carcinoma
    109385353 (AKT3)
   05226 Gastric cancer
    109385353 (AKT3)
   05214 Glioma
    109385353 (AKT3)
   05221 Acute myeloid leukemia
    109385353 (AKT3)
   05220 Chronic myeloid leukemia
    109385353 (AKT3)
   05218 Melanoma
    109385353 (AKT3)
   05211 Renal cell carcinoma
    109385353 (AKT3)
   05215 Prostate cancer
    109385353 (AKT3)
   05213 Endometrial cancer
    109385353 (AKT3)
   05224 Breast cancer
    109385353 (AKT3)
   05222 Small cell lung cancer
    109385353 (AKT3)
   05223 Non-small cell lung cancer
    109385353 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109385353 (AKT3)
   05017 Spinocerebellar ataxia
    109385353 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109385353 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109385353 (AKT3)
   04931 Insulin resistance
    109385353 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109385353 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109385353 (AKT3)
   05135 Yersinia infection
    109385353 (AKT3)
   05152 Tuberculosis
    109385353 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109385353 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    109385353 (AKT3)
   05162 Measles
    109385353 (AKT3)
   05164 Influenza A
    109385353 (AKT3)
   05161 Hepatitis B
    109385353 (AKT3)
   05160 Hepatitis C
    109385353 (AKT3)
   05168 Herpes simplex virus 1 infection
    109385353 (AKT3)
   05163 Human cytomegalovirus infection
    109385353 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109385353 (AKT3)
   05169 Epstein-Barr virus infection
    109385353 (AKT3)
   05165 Human papillomavirus infection
    109385353 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109385353 (AKT3)
   05142 Chagas disease
    109385353 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109385353 (AKT3)
   01524 Platinum drug resistance
    109385353 (AKT3)
   01522 Endocrine resistance
    109385353 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109385353 (AKT3)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109385353 (AKT3)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109385353 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 109385353
NCBI-ProteinID: XP_019503124
LinkDB
Position
Un
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttctcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgtcatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctattcaggcggtagcagacagacttcagaggcaagaagaggagagaatgaactgtagt
ccaacttcgcaaattgataatatcggggaggaagaaatggatgcttctacaactcatcac
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcgagtgggaaatattatgctatgaagattctgaag
aaagaagttattattgcaaaggatgaagtggcacacactctaacagaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctgcattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gctaccatgaagacgttctgtggcacaccagaatacctggccccagaggtattagaagat
aatgactatggccgagctgtggattggtggggcctcggtgttgtcatgtatgaaatgatg
tgtgggcggttacctttttacaaccaggatcatgagaaactttttgaactaatactaatg
gaagacattaaatttccacgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttctctggagtaaattggcaagatgtatacgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagataccagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcacttccctcagttttcctactctgcaagtggacgcgaataa

KEGG   Hipposideros armiger (great roundleaf bat): 109385878
Entry
109385878         CDS       T04661                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04261  Adrenergic signaling in cardiomyocytes
hai04370  VEGF signaling pathway
hai04371  Apelin signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04728  Dopaminergic synapse
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04920  Adipocytokine signaling pathway
hai04922  Glucagon signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04973  Carbohydrate digestion and absorption
hai05010  Alzheimer disease
hai05017  Spinocerebellar ataxia
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109385878
   04012 ErbB signaling pathway
    109385878
   04014 Ras signaling pathway
    109385878
   04015 Rap1 signaling pathway
    109385878
   04370 VEGF signaling pathway
    109385878
   04371 Apelin signaling pathway
    109385878
   04630 JAK-STAT signaling pathway
    109385878
   04668 TNF signaling pathway
    109385878
   04066 HIF-1 signaling pathway
    109385878
   04068 FoxO signaling pathway
    109385878
   04072 Phospholipase D signaling pathway
    109385878
   04071 Sphingolipid signaling pathway
    109385878
   04024 cAMP signaling pathway
    109385878
   04022 cGMP-PKG signaling pathway
    109385878
   04151 PI3K-Akt signaling pathway
    109385878
   04152 AMPK signaling pathway
    109385878
   04150 mTOR signaling pathway
    109385878
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109385878
  09143 Cell growth and death
   04210 Apoptosis
    109385878
   04218 Cellular senescence
    109385878
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109385878
   04550 Signaling pathways regulating pluripotency of stem cells
    109385878
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109385878
   04620 Toll-like receptor signaling pathway
    109385878
   04625 C-type lectin receptor signaling pathway
    109385878
   04660 T cell receptor signaling pathway
    109385878
   04662 B cell receptor signaling pathway
    109385878
   04664 Fc epsilon RI signaling pathway
    109385878
   04666 Fc gamma R-mediated phagocytosis
    109385878
   04062 Chemokine signaling pathway
    109385878
  09152 Endocrine system
   04910 Insulin signaling pathway
    109385878
   04922 Glucagon signaling pathway
    109385878
   04923 Regulation of lipolysis in adipocytes
    109385878
   04920 Adipocytokine signaling pathway
    109385878
   04929 GnRH secretion
    109385878
   04915 Estrogen signaling pathway
    109385878
   04914 Progesterone-mediated oocyte maturation
    109385878
   04917 Prolactin signaling pathway
    109385878
   04926 Relaxin signaling pathway
    109385878
   04935 Growth hormone synthesis, secretion and action
    109385878
   04919 Thyroid hormone signaling pathway
    109385878
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109385878
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109385878
  09156 Nervous system
   04725 Cholinergic synapse
    109385878
   04728 Dopaminergic synapse
    109385878
   04722 Neurotrophin signaling pathway
    109385878
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109385878
  09149 Aging
   04211 Longevity regulating pathway
    109385878
   04213 Longevity regulating pathway - multiple species
    109385878
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385878
   05205 Proteoglycans in cancer
    109385878
   05230 Central carbon metabolism in cancer
    109385878
   05231 Choline metabolism in cancer
    109385878
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109385878
  09162 Cancer: specific types
   05210 Colorectal cancer
    109385878
   05212 Pancreatic cancer
    109385878
   05225 Hepatocellular carcinoma
    109385878
   05226 Gastric cancer
    109385878
   05214 Glioma
    109385878
   05221 Acute myeloid leukemia
    109385878
   05220 Chronic myeloid leukemia
    109385878
   05218 Melanoma
    109385878
   05211 Renal cell carcinoma
    109385878
   05215 Prostate cancer
    109385878
   05213 Endometrial cancer
    109385878
   05224 Breast cancer
    109385878
   05222 Small cell lung cancer
    109385878
   05223 Non-small cell lung cancer
    109385878
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109385878
   05017 Spinocerebellar ataxia
    109385878
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109385878
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109385878
   04931 Insulin resistance
    109385878
   04933 AGE-RAGE signaling pathway in diabetic complications
    109385878
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109385878
   05135 Yersinia infection
    109385878
   05152 Tuberculosis
    109385878
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109385878
   05170 Human immunodeficiency virus 1 infection
    109385878
   05162 Measles
    109385878
   05164 Influenza A
    109385878
   05161 Hepatitis B
    109385878
   05160 Hepatitis C
    109385878
   05168 Herpes simplex virus 1 infection
    109385878
   05163 Human cytomegalovirus infection
    109385878
   05167 Kaposi sarcoma-associated herpesvirus infection
    109385878
   05169 Epstein-Barr virus infection
    109385878
   05165 Human papillomavirus infection
    109385878
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109385878
   05142 Chagas disease
    109385878
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109385878
   01524 Platinum drug resistance
    109385878
   01522 Endocrine resistance
    109385878
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109385878
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109385878
Protein kinases [BR:hai01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109385878
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C Seadorna_VP7
Other DBs
NCBI-GeneID: 109385878
NCBI-ProteinID: XP_019504110
LinkDB
Position
Un
AA seq 476 aa
MNEVSVIKEGWLHKRGEFIKTWRPRYFLLKSDGSFIGYKERPEDPDQTLPPLNNFSVAEC
QLMKTEIPRPNTFVIRCLQWTTVIERTFYVDSPDEREEWMQAIQMVADSLKQRGPGEDPV
DSKCGSPSDSSAAEEMEGAVSSAQAMVTMNDFDYLKFLGKGTFGKVILVQEKATGHYYAM
KILRKEVIIARDEVAHTVTESRVLQNTRHPFLTALRYAFQTHDRLCFVMEFAIGGELFFH
LSRERVFTEERVRFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMRTFCGTPEYLAPEVLDDNDYSRAVDWWGLGVVMYEMMCGHLPFYNEDHERLFE
LILTEEIHFPRTLTPEATALLTELLKKDPKQRLGGGPSDAKEVREHRFFLSINWQDVVEK
KLLPPFIPQVTSEVDTRYFDDEFTSQSITLTPPDRKDNLDQPTLFPQFSYSASIRE
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaattcataaag
acttggaggccccggtacttcctgctgaagagtgatggctccttcattggatataaggaa
cggccagaggaccctgaccagaccctgccccccctaaacaacttctccgttgcagaatgc
cagctgatgaagaccgagataccaaggcccaacacctttgtcatacgctgcctgcagtgg
accacagtcattgagaggaccttctatgtagactctccagatgagagggaggagtggatg
caggctatccagatggtcgctgacagcctcaagcagcggggcccaggtgaggaccccgtg
gactccaagtgtggctcccctagtgactcttccgcagctgaggagatggaaggggcagtt
agcagtgcccaggccatggtgactatgaatgacttcgactatctcaaatttctcggcaag
ggcacctttggcaaagtgatcctggtgcaggagaaggccactggccactactacgccatg
aagatcctgcggaaggaggttatcattgccagggatgaagttgcccacaccgtcactgag
agccgagtcctccagaacaccaggcacccattcctcactgccctgcgatatgccttccag
acccacgaccgcctgtgctttgtgatggagttcgccatcggtggtgagctattcttccac
ctgtcccgggaacgtgtcttcacggaggagcgggtccgcttttatggcgcagagatcgtt
tcagccctggagtacttgcattcacgggacgtggtgtaccgtgacatcaagctggaaaat
ctcatgctggacaaagatggccacatcaagatcacagactttggcctgtgcaaagagggc
atcagtgacggggccaccatgagaaccttctgtggaacccccgaatacctggcacctgag
gtgctggatgacaatgactacagccgggctgtggactggtgggggctgggcgtggtcatg
tatgagatgatgtgcggccacctgcccttctacaacgaggaccatgagcgccttttcgag
ctcatcctcacggaggagatccacttcccacgcacactcacccctgaggccacggccctt
cttaccgagctgcttaagaaggaccccaagcagaggctaggcggggggcccagcgatgcc
aaggaggtcagggagcacaggttctttctcagcatcaactggcaggacgtggtagagaag
aagctcctgccacccttcatacctcaggtcacatctgaggtcgacacaaggtacttcgat
gatgagttcacctcccagtccatcacactcacgcccccggaccgcaaggacaacctggac
cagccgaccctcttcccccagttctcctactcggccagcatccgcgagtga

DBGET integrated database retrieval system