KEGG   Hipposideros armiger (great roundleaf bat): 109375142Help
Entry
109375142         CDS       T04661                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00500  Starch and sucrose metabolism
hai01100  Metabolic pathways
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04910  Insulin signaling pathway
hai04922  Glucagon signaling pathway
hai04931  Insulin resistance
Module
hai_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109375142 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109375142 (GYS2)
   04152 AMPK signaling pathway
    109375142 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109375142 (GYS2)
   04922 Glucagon signaling pathway
    109375142 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    109375142 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hai01003]
    109375142 (GYS2)
Enzymes [BR:hai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     109375142 (GYS2)
Glycosyltransferases [BR:hai01003]
 Polysaccharide
  Storage polysaccharide
   109375142 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 109375142
NCBI-ProteinID: XP_019485908
LinkDB All DBs
Position
Un
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLSGLPQWEVEELPVQDLLLFEVAWEVTNKVGGIYTVIQTKARTTVDEWG
DNYFLIGPYFEQNMKTQVEQCEPVNYTVKRAVETMNKHGCQVRFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHMEDKHVIAHFH
EWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFDIDKEAGERQIYH
RYCMERAAVHCAHVFTTVSEITAIEAEHMLRRKPDVVTPNGLNVKKFSAVHEFQNLHATY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPDMHNIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHMEPTTPPTTEGFKYPRPSSVPPSPTGSQVSSPQSSDVE
DEDEDERYNEEEEAERDRINIKSPFSLGPVPHGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccggtccctctctgtgacatccctgagtgggcttcctcagtgggaagtt
gaagaacttcccgtgcaggatttactgctctttgaagtcgcttgggaagtgaccaataaa
gttggtggcatctatactgtgatccagacaaaggccagaacaacagtggatgaatgggga
gacaattattttctgattggcccatattttgagcaaaacatgaagacacaggtggaacag
tgtgaacctgtaaattatactgttaaaagagcagtggagacaatgaataaacatggctgc
caggtacgttttggaagatggctgatagaagggagtccttacgtggtgctctttgacata
gggtattcggcttggaatctggacaggtggaaaggtgacctctgggaagcatgcagtgtc
ggcatcccttatcacgaccgagaagccaatgatatgttgatatttggatctttaactgcc
tggttcttaaaagaggtgacagaccatatggaagacaaacacgtcattgcccatttccat
gaatggcaggccggaattggactgatcctttctcgtgcccggaaacttcccatcgctacg
atatttaccacccatgccacactgcttgggaggtatctttgcgcagcaaacattgatttc
tacaatcatcttgataagtttgacatagacaaagaggctggggaaaggcagatttatcat
cggtattgcatggagcgagcggcagtccactgtgctcatgtgttcaccacagtttctgaa
ataacagcaatagaggcagaacatatgctcaggagaaagcctgatgtagttactccaaat
ggtttaaatgttaaaaaattttcagcagtacatgaatttcaaaatctacatgcaacgtac
aaggccaggatacaggattttgttcgaggtcatttctatggtcatctggactttgatctt
gaaaagactttgttccttttcattgctgggaggtatgagttttcaaacaaaggagctgac
atcttcctagaatccttatccaggttaaatttcttgctgaggatgcataaaagtgacgtc
acggtggtggtgtttttcattatgcctgccaagacaaataatttcaatgtggaaacactg
aaaggccaggcagtgcgcaaacagctgtgggacactgcacattcagtgaaggaaaagttt
ggaaagaaactctatgatgcattattaagaggagaaattcctgacatgcataatattttg
gatcgagatgatctcacaattatgaaaagggccatcttttcaactcagcgacagtctttg
cctccagtgaccactcacaacatgattgatgactctactgatcccatcctcagcaccatt
agacggattggacttttcaacagccgcactgacagagtcaaggtgattttgcacccagag
ttcctatcctccaccagccccttgttacccatggattatgaggagttcgtccgaggctgt
catcttggagtattcccgtcatactatgaaccgtggggttatactccagccgaatgcact
gtgatgggcatccccagtgtgacgaccaacctctccggctttggctgtttcatgcaggag
cacgtggctgatcctactgcatatggtatctacattgttgataggcggttccgctctcca
gatgattcttgcaatcagctgactcagtttctgtacggattttgcaaacagtcacgtcgc
caaagaataatccagaggaaccgaactgaaaggctctcagatcttctggattggagatac
ttaggcagatattaccagcatgccaggcacctgacattaagcagagcctttccagataaa
ttccatatggaacccacaacaccaccaacgacagaaggatttaaatatcccaggccttcc
tcagtaccaccctctcctacagggtctcaggtctccagtcctcagagcagtgatgtggaa
gatgaagatgaggatgagagatacaatgaggaagaggaggcagaaagggatcggataaac
attaagtcaccattttctttgggtcctgttcctcatgggaagaaaaagttgcatggtgaa
tacaagaactga

DBGET integrated database retrieval system