KEGG   Hipposideros armiger (great roundleaf bat): 109375221
Entry
109375221         CDS       T04661                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04062  Chemokine signaling pathway
hai04068  FoxO signaling pathway
hai04072  Phospholipase D signaling pathway
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04510  Focal adhesion
hai04540  Gap junction
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04714  Thermogenesis
hai04722  Neurotrophin signaling pathway
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04912  GnRH signaling pathway
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04926  Relaxin signaling pathway
hai04935  Growth hormone synthesis, secretion and action
hai05034  Alcoholism
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109375221 (SOS2)
   04012 ErbB signaling pathway
    109375221 (SOS2)
   04014 Ras signaling pathway
    109375221 (SOS2)
   04630 JAK-STAT signaling pathway
    109375221 (SOS2)
   04068 FoxO signaling pathway
    109375221 (SOS2)
   04072 Phospholipase D signaling pathway
    109375221 (SOS2)
   04151 PI3K-Akt signaling pathway
    109375221 (SOS2)
   04150 mTOR signaling pathway
    109375221 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109375221 (SOS2)
   04540 Gap junction
    109375221 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109375221 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109375221 (SOS2)
   04660 T cell receptor signaling pathway
    109375221 (SOS2)
   04662 B cell receptor signaling pathway
    109375221 (SOS2)
   04664 Fc epsilon RI signaling pathway
    109375221 (SOS2)
   04062 Chemokine signaling pathway
    109375221 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109375221 (SOS2)
   04912 GnRH signaling pathway
    109375221 (SOS2)
   04915 Estrogen signaling pathway
    109375221 (SOS2)
   04917 Prolactin signaling pathway
    109375221 (SOS2)
   04926 Relaxin signaling pathway
    109375221 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    109375221 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109375221 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    109375221 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109375221 (SOS2)
   05206 MicroRNAs in cancer
    109375221 (SOS2)
   05205 Proteoglycans in cancer
    109375221 (SOS2)
   05231 Choline metabolism in cancer
    109375221 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109375221 (SOS2)
   05225 Hepatocellular carcinoma
    109375221 (SOS2)
   05226 Gastric cancer
    109375221 (SOS2)
   05214 Glioma
    109375221 (SOS2)
   05221 Acute myeloid leukemia
    109375221 (SOS2)
   05220 Chronic myeloid leukemia
    109375221 (SOS2)
   05211 Renal cell carcinoma
    109375221 (SOS2)
   05215 Prostate cancer
    109375221 (SOS2)
   05213 Endometrial cancer
    109375221 (SOS2)
   05224 Breast cancer
    109375221 (SOS2)
   05223 Non-small cell lung cancer
    109375221 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    109375221 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109375221 (SOS2)
   05160 Hepatitis C
    109375221 (SOS2)
   05163 Human cytomegalovirus infection
    109375221 (SOS2)
   05165 Human papillomavirus infection
    109375221 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109375221 (SOS2)
   01522 Endocrine resistance
    109375221 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hai04990]
    109375221 (SOS2)
Domain-containing proteins not elsewhere classified [BR:hai04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   109375221 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N Histone PH RhoGEF IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 109375221
NCBI-ProteinID: XP_019486008
LinkDB
Position
Un
AA seq 1284 aa
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPNLSATEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLISLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDKKLFKPSEQ
AFDPYETLSQDILSPKFNEHFSKVMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHC
WHYFELLKQLKACSEEEDDKECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNR
QLRSKHLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMIS
CKPNHSQTRLPGYSSAEYRLKEKFVMRKIQIFDKEDTCEYKHAFELVSKDENSIIFAAKS
AEEKNNWMAALISLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFED
NLQSRSAIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEI
PEPEPTEADKLAVEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLEL
LERLESFISSVRGKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQ
FETFDLMTLHPIEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTN
LTLWFEKCIVEAENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTF
EALQERKRRILDEAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKK
KGKDLINFSKRRKVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLF
NKSLEIEPRNCKQPPRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRCHPTPLEREPCKISF
SRIAETEIESTASAPTSPNTPSTPPVSASSDLSVFLDVDLSSSCGSNSIFAPVLLPHSKS
FFSSCGSLHKLSEEPLIPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPR
VPAPTGAFDGPLHSPPPPPPRDPLPDTPPPVPFRPPEHFINCPFNLQPPPLGHLHRDPDW
FRDVSTCPNSPNTPPSTPSPRVPRRCHVLSSSHNNLAHSQAPPVPPRQNSSPHLPKLPPK
TYKRELSHPPLYRLPLLENAETPQ
NT seq 3855 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccgtacgagttcttcagcgaagagaacagtccgaaatggcgg
ggactgttggtctcggccctgcggaaggttcaggagcaagtacaccccaatctctcagct
actgaagagtctctctactatattgaagagctgatttttcagctgcttaataaattatgc
atggcacaaccaaggactgtccaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgctatagagaaacgaaaacgaaga
aatcctctcttactgcctgtggacaaaatccatccttcactgaaggaagttttagggtac
aaagtggactaccatgtgtccttatatattgtggctgtcctagagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatattcgacattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggtttgatttctctctgtgaagatgaacctagttcttcaggtgaattaaactactat
gacctcgttagaactgaaattgcagaagaaagacagtatctacgggaactaaatatgatt
ataaaagtgtttcgagaagcctttctttctgacaaaaagctgtttaaaccttctgagcaa
gcatttgatccttatgaaacattatcacaggacattctttcaccaaaatttaatgaacat
ttcagtaaggtgatggccagacctgccgtggctctacactttcagtccattgctgatggt
tttaaagaggcagttcgttatgtccttccacgccttatgctggtgccagtgtatcattgt
tggcactattttgaattattgaagcaattgaaagcatgtagtgaagaagaagacgacaaa
gaatgtttgaaccaagctattactgctctcatgaatctccaaggtagtatggaccgaatt
tacaagcagtattcacctcgacgccgacctggggatcctgtttgccctttttataatcgc
caattaagaagcaagcacctggctattaaaaaaatgaatgaaattcagaaaaacatagat
ggatgggaaggcaaagatattggacaatgttgtaatgaatttattatggaaggtccattg
acaagaattggtgctaaacatgaacggcatatttttctctttgatggcttaatgattagt
tgtaaacccaatcatagccagacacgccttccaggttacagtagtgccgaatacagatta
aaagaaaaatttgtcatgagaaaaatacaaatatttgacaaggaagatacttgtgagtac
aaacatgcttttgaattagtatccaaagatgaaaacagcataatatttgctgctaagtct
gctgaagagaaaaataattggatggcagcacttatttctcttcattatcgtagtactcta
gatcgaatgttagattcagtattattgaaagaagaaaatgagcaaccactgagattacca
agtcctgaagtatatcgttttgtggtaaaagactctgaggaaaacattgtttttgaagac
aacttgcaaagtagaagtgcaatccccattattaaaggaggaactgtggtgaaattaatt
gaaaggttaacatatcatatgtatgcagatcccaattttgttcgtacttttcttactaca
tatcgttcattttgtaaaccacaggaattgctaagcttattgattgaaagatttgaaatt
ccagagccagaacctactgaagcagataaattggcagtagagaaaggcgagcagccaatt
agtgcagaccttaaaaggtttcgcaaggaatatgtccaaccagtacaacttaggatctta
aatgtgtttcggcactgggttgaacaccatttttatgactttgaaagagatttggagttg
cttgaaagactagaatccttcatttcaagtgtaagagggaaagccatgaagaaatgggta
gagtcaattgctaagatcatcaagaggaagaaacaagctcaggcaaatggaataagccat
aatattacttttgaaagtccacctccacctattgaatggcatatcagcagaccaggacaa
tttgaaacatttgatctcatgacccttcatccaatagaaattgcacgtcagctgacactt
ttggaatctgatctctacaggaaagttcaaccttctgaacttgtagggagtgtatggacc
aaagaagataaagaaataaattctcccaatttattaaaaatgattcgccacaccacaaat
ctgactctctggtttgaaaagtgcattgtggaagcagaaaattttgaggaacgggttgca
gtactaagtagaattatagaaattctgcaagtttttcaagatttgaataatttcaatggt
gtattggagatagtcagtgcagtaaattcagtgtcagtatacagactagaccacaccttt
gaggctttacaggaaaggaaaaggagaattttggatgaagctgtggaattaagtcaagat
cactttaaaaaatacctagtgaagcttaagtcaatcaatccaccttgtgtgccttttttt
ggaatatatttaacaaatattctgaagactgaagaagggaataatgattttttaaaaaag
aaagggaaagatttaatcaatttcagtaagaggaggaaagtggctgaaattactggagaa
attcagcagtatcagaatcaaccttattgtttacggatagaaccagaaatgaggcggttc
tttgaaaaccttaaccccatgggaagtgcttctgaaaaagagtttacagattatttgttc
aacaagtcgctagaaattgaaccccgaaactgtaaacagccacctcgatttcctaggaaa
tcaactttctctttaaaatctcctggaataaggcctaatgcaggccgacatggctctacc
tcaggcactttacgatgtcatccaacaccattagaaagagagccatgtaaaataagcttt
agtcggattgctgaaactgagattgaatcaacagcatcagcaccaacctctccaaataca
ccatctactccaccagtatctgcttcttcagatcttagtgtgtttttagatgtggatctc
agcagttcctgtggcagcaatagcatctttgctccagttctcttgccacattcaaagtct
ttcttcagttcgtgtggtagtttacataaactaagtgaagagccattgattcctccacct
cttcctcctcgaaaaaagtttgatcatgatgcttcaaattccaagggaaatatgaagtct
gatgatgaccctcctgctattccaccaagacaacctcctcctccaaaggtaaaacccaga
gttcctgctcccactggtgcatttgacgggcctctgcacagtccacctccaccaccgcca
agagatcctcttcctgacacccctccgccggttccctttcggcctccagaacactttata
aactgtccatttaatctccagccacctccactgggacaccttcacagagatccagactgg
ttcagagatgttagtacatgtccaaattcgccaaacactcctcctagcacaccctctcca
agggtgccacgtcgatgccatgtgctcagttctagccacaataatcttgctcattctcaa
gctccccctgttccgccaagacagaattcaagccctcacctaccaaaactgccaccaaag
acttacaaacgagagctttcacaccccccattgtatagactgcctttgctagaaaatgca
gaaactcctcaatga

KEGG   Hipposideros armiger (great roundleaf bat): 109385471
Entry
109385471         CDS       T04661                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04062  Chemokine signaling pathway
hai04068  FoxO signaling pathway
hai04072  Phospholipase D signaling pathway
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04510  Focal adhesion
hai04540  Gap junction
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04714  Thermogenesis
hai04722  Neurotrophin signaling pathway
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04912  GnRH signaling pathway
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04926  Relaxin signaling pathway
hai04935  Growth hormone synthesis, secretion and action
hai05034  Alcoholism
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109385471 (SOS1)
   04012 ErbB signaling pathway
    109385471 (SOS1)
   04014 Ras signaling pathway
    109385471 (SOS1)
   04630 JAK-STAT signaling pathway
    109385471 (SOS1)
   04068 FoxO signaling pathway
    109385471 (SOS1)
   04072 Phospholipase D signaling pathway
    109385471 (SOS1)
   04151 PI3K-Akt signaling pathway
    109385471 (SOS1)
   04150 mTOR signaling pathway
    109385471 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109385471 (SOS1)
   04540 Gap junction
    109385471 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109385471 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109385471 (SOS1)
   04660 T cell receptor signaling pathway
    109385471 (SOS1)
   04662 B cell receptor signaling pathway
    109385471 (SOS1)
   04664 Fc epsilon RI signaling pathway
    109385471 (SOS1)
   04062 Chemokine signaling pathway
    109385471 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109385471 (SOS1)
   04912 GnRH signaling pathway
    109385471 (SOS1)
   04915 Estrogen signaling pathway
    109385471 (SOS1)
   04917 Prolactin signaling pathway
    109385471 (SOS1)
   04926 Relaxin signaling pathway
    109385471 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    109385471 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109385471 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    109385471 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385471 (SOS1)
   05206 MicroRNAs in cancer
    109385471 (SOS1)
   05205 Proteoglycans in cancer
    109385471 (SOS1)
   05231 Choline metabolism in cancer
    109385471 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109385471 (SOS1)
   05225 Hepatocellular carcinoma
    109385471 (SOS1)
   05226 Gastric cancer
    109385471 (SOS1)
   05214 Glioma
    109385471 (SOS1)
   05221 Acute myeloid leukemia
    109385471 (SOS1)
   05220 Chronic myeloid leukemia
    109385471 (SOS1)
   05211 Renal cell carcinoma
    109385471 (SOS1)
   05215 Prostate cancer
    109385471 (SOS1)
   05213 Endometrial cancer
    109385471 (SOS1)
   05224 Breast cancer
    109385471 (SOS1)
   05223 Non-small cell lung cancer
    109385471 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    109385471 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109385471 (SOS1)
   05160 Hepatitis C
    109385471 (SOS1)
   05163 Human cytomegalovirus infection
    109385471 (SOS1)
   05165 Human papillomavirus infection
    109385471 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109385471 (SOS1)
   01522 Endocrine resistance
    109385471 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hai04990]
    109385471 (SOS1)
Domain-containing proteins not elsewhere classified [BR:hai04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   109385471 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 109385471
NCBI-ProteinID: XP_019503342
LinkDB
Position
Un
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSVSDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDECSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDTALLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLSHGPRSASVSSISL
TKGTDEGPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSISDAPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcgcccaagtggcgg
gggctgctggtgcctgcgctgaaaaaggtccaggggcaagttcatcctactcttgagtct
agtgatgatgctcttcagtatgttgaagaattaattttgcagctattaaatatgctatgc
caagctcagccccgaagtgtttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagaggaaacgaaga
aaccctttatctctcccagtagaaaaaattcatcctttattaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttatatagtagcagtattagaatatatttctgcagac
attttaaagctggtggggaattatgtacgaaatatacggcattatgaaattacaaaacaa
gatattaaagtagcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatatattatctttaactgatgaagaaccttccacctcaggagagcaaact
tactatgatttggtaaaagcatttatggcagaaattcgacaatacataagggagctaaat
ttaattataaaagtttttagagagccctttgtctccaactcaaaattgttttcagctaat
gatgtagaaaatatatttagtcggatagtagatatacatgaacttagtgtaaaattactg
ggccatatagaagatactgtagaaatgactgatgaatgcagtccccatccattagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattttacgacctggttttcatgatcgtttccttagtcagttatcaaagcctggagca
gcactttatttgcagtcaataggcgaaggtttcaaagaagctgttcaatatgttttaccc
aggctgcttctagccccagtttaccactgtctacattactttgaacttttgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaataacagcgttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttacagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaatgagattcagaagaacattgatggttgggaggggaaggacattggacagtgt
tgcaatgagtttataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcaaccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaaattttttatgagaaaggtacaa
attaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagcagaagagaaaaacaactggatggcagcg
ctgatatctttacagtaccggagtacactagagaggatgcttgatgtgacgatgctgcag
gaagagaaggaggagcagatgaggctccccagtgctgatgtgtatagatttgcagagcct
gactctgaagagaatataatatttgaagaaaacatgcagcccaaggctggaattccaatt
atcaaagcaggaactgttattaaacttatagagaggctcacatatcatatgtatgcagat
cccaattttgttcggacatttcttacgacatacagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagcagatcgc
atagctatagagaatggagatcaacccttgagcgcagaactaaaaagatttagaaaagaa
tatatacagcctgtacaactgcgagtattaaatgtatgtcggcactgggtagagcaccac
ttctacgattttgaaagagatacagctcttttgcagcgaatggaggaatttattggaaca
gtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccgggtcataatattacatttcaaagttcacctcccaca
gttgagtggcatataagcagacctggacacatagagacgtttgacctgctcaccttacat
ccaatagaaattgctcgacaactcactttacttgaatcagatctatatcgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
cttctgaaaatgatccggcacaccactaatctcacgctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgagattctgcaa
gtctttcaagagctgaacaacttcaatggtgtccttgaggttgtcagtgctatgaactcc
tcacctgtttacaggctagaccacacgtttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaattaagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctaactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaaggcatggaaaagagcttataaactttagtaaa
aggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcagccttattgt
ttacgagtagaatcagatatcaaaaggttctttgaaaacttgaatccaatgggaaatagc
atggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctcttccaagatttccaaaaaaatatagttatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtaccatgagacatcccacacctctgcagcaggagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagaaagtaccgcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttctagtaccacagat
gtttgcagcgtatttgattccgatcattcgagcccttttcactcaagcagcgataccgtc
tttatccaagttacactgtcccatggcccaagatctgcttcagtgtcatctataagttta
accaagggcactgacgaaggtcccgtcccccctcctgtccctccacggagaagaccagag
tctgccccagcggagtcgtcaccatcgaagattatgtctaagcatttggacagcccccca
gcaattcctcctaggcaacccacatcaaaagcttattcaccacgatactcaatatcagac
cggacctctatatcagatgctcctgaaagccctcccttattaccaccacgagaacctgtg
aggacacctgatgttttctcaagctcaccactacatctccaacctccccctttgggcaaa
aaaagcgatcacggcaatgctttcttcccaaacagcccttccccctttacaccacctcct
cctcagacaccttctcctcatggcaccagaaggcatctgccgtcaccgccattgacacaa
gaagtggaccttcattccattgctgggccacctgttcctccgcgacaaagcacttctcag
catatccctaaactccctccaaaaacttacaaaagggagcacacacacccatccatgcac
agagatggaccaccactgctggagaatgcccattcttcttga

DBGET integrated database retrieval system