KEGG   Hipposideros armiger (great roundleaf bat): 109375560
Entry
109375560         CDS       T04661                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04630  JAK-STAT signaling pathway
hai04640  Hematopoietic cell lineage
hai05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109375560 (IL3RA)
   04151 PI3K-Akt signaling pathway
    109375560 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109375560 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109375560 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109375560 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109375560 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hai04050]
    109375560 (IL3RA)
   04090 CD molecules [BR:hai04090]
    109375560 (IL3RA)
Cytokine receptors [BR:hai04050]
 Interleukin receptor families
  IL3 receptor family
   109375560 (IL3RA)
CD molecules [BR:hai04090]
 Proteins
  109375560 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind PilA4 EpoR_lig-bind
Other DBs
NCBI-GeneID: 109375560
NCBI-ProteinID: XP_019486543
LinkDB
Position
Un
AA seq 391 aa
MALLWLAAFLTPVSCVLPTDRSHHQVPSADPQPPIKNLRMETKSKMLAWDVTGNISSIKC
FKDSKNSSKGQTQKSCTFYVLPKCKASNYTVNVTTVDGKSFSTWIRYPEQEGNPGAAAQG
LECQVHDVDFLTCGWKVGPEAPSDVQYSSYLENVKTENKWECPRHTANGLGIHVQCQFKG
LSRFPHVQYRFLVNGNSTHSSIPCAECIMYLSHIEELSPPNMTVSCNKSHSVIEWKTRSH
FYRKIEYELEIQKGTDDPYTQKAHLKTSLILSSPGVYTVKVRAMVLRYTNQKKGTSQWSA
PQRIACHQDENAPLHFWLTPLLIALATLTFAGCALLLCKRYSLRQKLFPPIPHMKDPIGD
GAHTENMLAWESDRAGPEECPVAKVQVLGEK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggccttgctttggctggcggcgtttctgacgcccgtgtcctgcgtgctgcccactgac
cgttcacatcaccaggtgccgtctgcagatccacagccaccgattaagaacttaaggatg
gaaacgaaaagcaaaatgctggcctgggacgtcacgggaaatatttctagcatcaaatgc
ttcaaagactccaagaactcctcaaagggacaaactcaaaagtcttgcacgttttacgtc
ctccccaagtgcaaagcgtcaaactacaccgtgaatgtcaccacggtggatgggaagtcg
ttttccacgtggattcggtacccggagcaagaagggaaccctggggcagccgcccagggc
ctggaatgccaggttcacgatgtggatttcctgacgtgcggatggaaggtgggccccgag
gcccccagcgacgtccaatattcctcgtacttggagaacgtgaaaacggaaaataagtgg
gagtgtccacgtcacacagccaacgggctggggattcacgtccagtgtcagttcaagggc
ctgtccaggttcccgcacgtccagtaccgtttcctggtgaatggcaacagcacgcactcc
agcatcccctgcgctgaatgtatcatgtacttgtcacatatcgaggaattaagtccaccc
aacatgaccgtgagctgtaataagtcccattccgtcatagaatggaaaacgcggagccac
ttctaccgcaagattgagtatgaactcgaaattcaaaagggcacagacgatccctacaca
cagaaggcccacttgaaaacctccctcatcctaagcagccccggagtctacacggtcaaa
gtcagggccatggtgctgcgctacaccaaccagaagaagggcaccagccagtggagtgcc
ccgcagcgcatcgcgtgccaccaagacgagaacgcgcctctccacttctggctgacgccg
ttgctgatcgcgctggccacgctgaccttcgcgggctgcgcgcttctcctgtgcaaaagg
tactcgctgcggcagaagctgttccctcccatcccccacatgaaagaccccatcggcgac
ggcgcgcacactgagaacatgttggcctgggagagtgacagagccggcccggaggagtgt
ccagtggccaaggtgcaggttttgggagaaaaatga

DBGET integrated database retrieval system