KEGG   Hipposideros armiger (great roundleaf bat): 109375630
Entry
109375630         CDS       T04661                                 

Gene name
IRF7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05164  Influenza A
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109375630 (IRF7)
   04621 NOD-like receptor signaling pathway
    109375630 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    109375630 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    109375630 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109375630 (IRF7)
  09172 Infectious disease: viral
   05162 Measles
    109375630 (IRF7)
   05164 Influenza A
    109375630 (IRF7)
   05161 Hepatitis B
    109375630 (IRF7)
   05160 Hepatitis C
    109375630 (IRF7)
   05168 Herpes simplex virus 1 infection
    109375630 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109375630 (IRF7)
   05169 Epstein-Barr virus infection
    109375630 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109375630 (IRF7)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    109375630 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 109375630
NCBI-ProteinID: XP_019486625
LinkDB
Position
Un
AA seq 490 aa
MAAAPESGTPRVLFADWLLGEVSSGRYEGLRWLDAARTRFRVPWKHFARKDLGEPDSRIF
KAWAVARGRWPLSSDTQTPEGALRASWKTNFRCALRSTQRFVMLQDNSGDSVDPHKVYQL
RSELGWREGPGSNQGEDQALEDAPHARGGLPGTCLAHAAEWQNPVSCAPSPLPGPAGPAG
DLLLQALQQSLLEDHLLEGVQEADPGPTEALGPELPTEELYLPGAAEVAPGPKSQPQPQM
TDAGPAPEPWTQTVGPSCPQLGLHAEPSLRVLEVTIMYKGRMVLQEVVGRPSCVLLYRAP
GLALEATEAQLVAFPSPAELPDQKQLHYTEKLLQHVAPGLQLELRGPVLWARRQGKCRVY
WEVGSPLGCDSPSTPARLLPRDRYTPIFDFHTFVRELVEFRARRRQGSPHYTIYLGFGQD
LSAGRPKERSLVLVKLEPWLCRAYLEGVQREGVSSLDTSSLSLCLSSSNSLYDDLEHFLD
HFSMEVEQPA
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggctgcggccccagagagcgggaccccgcgcgtgctgtttgcagactggcttttgggc
gaggtaagcagcggccgctacgaggggctgcggtggctcgacgcggcccgcacgcgcttc
cgcgtcccctggaagcactttgcgcggaaggatctgggagagcccgattcgcgcatcttc
aaggcttgggccgtggcccgcggcaggtggccgctcagcagcgacactcagacccccgag
ggggcgctcagggccagctggaaaaccaacttccggtgcgcgctgcgcagcacgcagcgt
ttcgtgatgctgcaggacaactcgggggactctgtcgacccgcataaggtgtaccagctc
aggtcggagctgggctggagagaaggtccaggcagtaaccagggcgaggaccaggccctc
gaagatgccccacacgcgaggggtgggctacccgggacgtgcctggcacatgctgctgag
tggcagaaccctgtgtcctgtgccccaagccctcttcctggcccagctggccccgccggg
gacctcctgcttcaggctctgcagcagagccttctggaggaccacctgctggaaggtgtg
caggaagcagacccaggccccacagaggctcttggtccagagcttcctaccgaggagctg
tacctgccaggggcagcggaggtggcccccggccccaagtcacagccccagccccaaatg
acagatgctggcccagccccggagccctggacccagacggtggggcccagctgcccacag
ctcggtctgcacgcagagcccagcctgagggtcctggaggtgaccatcatgtacaagggc
cggatggtgctgcaggaggtggtgggacgccccagctgcgtgctgctgtacagggcccct
ggcctggctcttgaggccactgaggcccagctggtggccttccccagcccggccgagctg
ccggaccagaagcagctccactacacagagaagttgctgcagcatgtggcccctggcctg
cagctcgagctccgggggcctgtgctgtgggcccggcgccagggcaagtgtagggtctac
tgggaggtgggcagccccctgggctgcgacagcccctccacgcccgcgcgcctgctgccg
agggaccgctacacgcccatctttgactttcacacctttgtccgagagctggtggaattc
cgggctcgcaggcgccagggctccccacactataccatctacctgggcttcgggcaggac
ctgtcggccgggagacccaaggagaggagcctggtcctggtgaagctggagccgtggctg
tgccgggcatacctggagggcgtgcagcgcgaaggcgtgtcctccctggacaccagcagc
ctcagcctctgcctgtctagcagcaacagcctgtatgatgacctggagcacttcctggac
cacttctcaatggaggtggagcagcccgcttag

DBGET integrated database retrieval system