KEGG   Hipposideros armiger (great roundleaf bat): 109375676Help
Entry
109375676         CDS       T04661                                 

Gene name
MARVELD2
Definition
(RefSeq) MARVEL domain containing 2
  KO
K17291  MARVEL domain-containing protein 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109375676 (MARVELD2)
Transporters [BR:hai02000]
 Other Transporters
  Others
   109375676 (MARVELD2)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   109375676 (MARVELD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 MARVEL Occludin_ELL Hepsin-SRCR DUF1986 SRCR Trypsin_2 MAP17 Med21 Ldl_recept_a DUF1682
Motif
Other DBs
NCBI-GeneID: 109375676
NCBI-ProteinID: XP_019486719
LinkDB All DBs
Position
Un
AA seq 1063 aa AA seqDB search
MSTNDGRSRNRDRHYDEVPRDLAYQDGTIRTLQTLHDIELAVSADPLPPPPLPLQPPFGP
DFYSSDTEEPAIAPDLKPVRRFVPESWKNFFRGKKKDPKWDKPVSDIRYISDGVECSPPA
SPIRPNHRSPPNSYKDTCGGSEGTYNSRKEAEAMLPQDPYGSLGRQTQTARTYSEKMEEY
NLRYSYMKSWAGLLRILGVVELLMGAGVFACVTAYIHKDSEWYNMFGYSPSNAMGGIGGL
GSMYGGYYYSGPKTPFVLVVAALAWITTIIILVLGMSMYYQTILLDSNWWPLTEFGINVA
LFILYMAAAIVYVNDINRGGLCYYPVFNTPMNAVFCRVEGGQIAAMIFLFVTMIVYLISA
LVCLKLWRHEAARRHREYMQQQEISELSLPSKRKMCEMAIGGDRPRDQEVNYKELRATKT
KTEVLSGHIPSGHIPKPIVLPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAI
LRKFDELDAVMSRLPHHSGNQQEHERISRIHEEFKKKKKRKTRDRLEVEKEEEEEEEEER
RAAAPGPAGQDAGHLEGFKYLPLPDAADQVRMALNSGSPPGVGPYYENHGYQPESLYPPQ
PAVAPSAYSVYRAGYYPPVVPQYTPRVLTNTSTPAIHTQPKSPSGTLCTSRTKKVLCITF
SLGAVLVGAVVAAVLLQKFMENKCSVSRIECGSSGTCVGASHWCTGVLHYPSGEDENRCV
RLYGPNFILQVYSSQRKSWHPVCQDDWSENYGRAACRDMGYRNSFYSSQGIVDDSGATSF
MKLNVSAGNTDFCKKLYHSDVCSSKAVVSLRCVECGVNTKMSCQNRIVGGMSAALGDWPW
QVSLHVQRVHVCGGSIITPEWIVTAAHCVEEPLNNPRYWTAFAGILRQSFMFYGNGYRVE
KVISHPNYDSKSKNNDIALMKLQTPLTFNNKVKPVCLPNPGLTLEPTQSCWISGWGASYE
KGKTSEMLNAVRVPLIEPRQCNSKYVYNNLITPAMICAGYLHGTIDSCQGDSGGPLVTLK
SSVWWLIGNTSWGSGCAKANRPGVYGNVTVFTDWIYQQMRANS
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaaacgatggaagatccaggaatcgggacaggcactacgatgaggtcccacgg
gacctggcctatcaagatggcaccataagaaccctccagactcttcatgacattgagctg
gctgtcagcgctgatcctttgccaccaccccctctcccattacagccaccattcggcccc
gacttctactcaagtgacacagaggaaccagccatagcaccagatctcaaacccgtgagg
cgctttgtccctgagtcctggaagaacttcttcagagggaagaaaaaggacccaaaatgg
gataagccggtgtcagacatcagatatatctccgacggagtggaatgctcaccgccagcc
tctccaataagaccaaaccaccgttcaccccccaactcctacaaagatacttgtggaggg
tcagaaggaacctataattcccggaaagaggccgaagcaatgcttcctcaggatccgtat
ggatctctaggccgacagacacaaacagctcgaacatacagtgagaagatggaggagtat
aacctgaggtattcctacatgaagtcgtgggcaggcctgctgagaattctgggtgtggtg
gagctgctcatgggggccggtgtttttgcttgtgtcacagcttacattcacaaggacagc
gagtggtataacatgtttggatattcaccatctaatgccatgggaggcattggtggcctg
ggcagtatgtatgggggctattactacagtggccccaaaactccttttgtactcgtggtt
gccgctttagcttggatcaccaccattattatcctggttcttggcatgtccatgtattat
cagaccattcttttggactctaactggtggcccctaactgaatttggaattaacgttgcc
ttgtttattttgtatatggctgcagccatagtctatgtgaatgatatcaaccgaggtgga
ctgtgctactatccagtatttaatacaccaatgaatgcagtgttctgccgggtagaagga
ggacagatcgcagcaatgatcttcttgtttgtcaccatgattgtttatctcattagtgct
ttggtttgcctaaagttatggaggcatgaggcagctcggagacatagggaatacatgcaa
cagcaggagataagtgagctatcattgccatcaaaaaggaaaatgtgtgaaatggccatc
ggtggtgacagaccgagagaccaagaagttaattacaaagaactgagagcaacaaaaacg
aaaactgaagtactgagtggacacatcccctcaggccacattcctaaacctatcgtgttg
cctgactatgtggcaaaataccctgtgattcagacggatgatgaacgagaacgctataaa
gctgtgttccaagaccagttttcagagtacaaagagctgtctgcagaagttcaagccatc
ttgaggaagtttgacgaactggacgcggtgatgagcagactgccacatcattcgggcaac
cagcaggaacatgagagaatttcaagaatccatgaagagtttaagaaaaaaaagaagagg
aagacgcgagatcggttggaagtggagaaggaagaggaggaagaggaggaggaagagcga
cgggcagcagcgccgggcccagcaggtcaagatgcaggtcatcttgaaggtttcaaatat
ctaccattacccgatgctgctgatcaagttaggatggctttaaactcaggatcaccacca
ggcgttggaccttactacgaaaaccatggataccagcctgagagcctctatcctccgcag
cccgctgtggcccccagtgcctactcggtgtatcgggctgggtattacccgcccgtggta
ccccagtacaccccaagggttctgacgaacacttcgacacctgccatccacacacagccc
aagtctccatcggggacactgtgcacctcaaggactaagaaagtgctgtgcatcaccttc
tccctgggggccgtcctcgtgggagcagtggtggccgctgtcttgctccagaaattcatg
gaaaacaagtgctccgtgtcccgaatcgagtgtggctcctcggggacctgcgtcggtgcc
tctcattggtgcaccggggtcctgcattaccccagcggggaggacgagaaccgatgcgtt
cgcctctatggacccaacttcatccttcaggtgtactcgtcccagaggaagtcctggcac
cccgtgtgccaagacgactggagcgagaactacgggagggcggcatgccgggacatgggc
tacaggaatagtttttattccagccaaggaatagtggatgacagcggggccaccagcttt
atgaagctgaatgtaagtgccggcaacaccgatttctgtaagaaactctaccacagtgat
gtctgttcttcaaaagcagtggtttcgttacgctgtgtagaatgcggggtcaacacgaag
atgagctgccagaatcggatcgtgggtgggatgagtgcagccctgggggactggccctgg
caggtcagcctgcacgtccaaagggtccacgtctgcggaggctccatcatcacccccgag
tggattgtgacagcagctcactgtgtcgaagaaccgcttaacaatccacggtattggacg
gccttcgcaggaattttgagacaatctttcatgttctatggaaacgggtaccgggtggaa
aaagtgatttctcatccaaattatgactcaaagagcaagaacaatgacatcgcgcttatg
aagctgcagacccctctgacttttaataacaaagtgaaacccgtgtgtctgcccaacccg
ggcttgacgttggagcccacacagtcctgctggatttccgggtggggtgccagctacgag
aaagggaaaacgtcggagatgctgaacgccgttagggttcccctcattgagccccggcaa
tgcaacagcaaatacgtctacaataacctgatcacgcccgccatgatctgcgcggggtat
ctgcatgggaccattgattcctgccagggtgacagtggcggtcctctggtcactttgaag
agcagcgtctggtggttgattgggaacaccagctgggggtctggctgtgccaaggctaac
agaccaggagtgtatggaaatgtgacagtatttacagactggatctatcaacaaatgagg
gcaaacagctaa

DBGET integrated database retrieval system