KEGG   Hipposideros armiger (great roundleaf bat): 109375870
Entry
109375870         CDS       T04661                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04014  Ras signaling pathway
hai04390  Hippo signaling pathway
hai04392  Hippo signaling pathway - multiple species
hai05200  Pathways in cancer
hai05206  MicroRNAs in cancer
hai05219  Bladder cancer
hai05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109375870 (RASSF1)
   04390 Hippo signaling pathway
    109375870 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    109375870 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109375870 (RASSF1)
   05206 MicroRNAs in cancer
    109375870 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    109375870 (RASSF1)
   05223 Non-small cell lung cancer
    109375870 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH DUF5111
Other DBs
NCBI-GeneID: 109375870
NCBI-ProteinID: XP_019486932
LinkDB
Position
Un
AA seq 272 aa
MGEADAGTPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLVRRPRRDQDEPVEWETP
DLSQAETEQKIKEYNGQVNSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPTLQDA
RRGPGRGTAVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERA
ERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRIL
QREEEEHLRQILKKYSYCRQKIQEALHACPLG
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggtgaggcagacgcggggacaccctctttcgagatgacctggagcagcacaacaagc
agtggctactgcagccaggaagattcggactcggagctcgagcagtactttacggcgcgt
acctcgttggtgcgccggcctcgccgggaccaggacgagcctgtggagtgggagacacct
gacctttctcaggctgagactgagcagaagatcaaggagtacaacggccaggtcaacagc
aacctcttcatgagcttgaacaaggacggctcctacacaggcttcattaaggttcaactg
aagttggtgcgccctgtctcagtgccctccagcaagaagccacccaccttgcaggatgcc
cggcggggcccagggcggggcacagctgtgaggcgccgcacctccttctacctgcccaag
gatgcggtcaagcacctccatgtgttgtcacgcacgcgagcacgagaggtcatcgaggct
ttgctgcgcaagttcttggtggtggatgacccccgcaagtttgcactctttgagcgagct
gagcgccatggccaagtgtacctccggaagctgtcagatgatgagcaacccctgcggcta
cggctccttgcaggccccagtgagaaggccctaagctttgtcctgaaggagaatgactct
ggggaggtgaattgggatgccttcagcatgcctgaattacacaacttcctacgcatcctg
cagcgggaggaagaggaacacctccgccagatcctgaagaagtactcctattgccgccag
aagatccaggaggccctgcacgcctgccccctagggtga

DBGET integrated database retrieval system