KEGG   Hipposideros armiger (great roundleaf bat): 109376052
Entry
109376052         CDS       T04661                                 

Gene name
NXF3
Definition
(RefSeq) nuclear RNA export factor 3
  KO
K14284  nuclear RNA export factor
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03008  Ribosome biogenesis in eukaryotes
hai03013  RNA transport
hai03015  mRNA surveillance pathway
hai05014  Amyotrophic lateral sclerosis
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109376052 (NXF3)
   03015 mRNA surveillance pathway
    109376052 (NXF3)
   03008 Ribosome biogenesis in eukaryotes
    109376052 (NXF3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109376052 (NXF3)
  09172 Infectious disease: viral
   05164 Influenza A
    109376052 (NXF3)
   05168 Herpes simplex virus 1 infection
    109376052 (NXF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109376052 (NXF3)
   03009 Ribosome biogenesis [BR:hai03009]
    109376052 (NXF3)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     109376052 (NXF3)
   mRNA cycle factors
    Stress granule specific factors
     109376052 (NXF3)
Ribosome biogenesis [BR:hai03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109376052 (NXF3)
SSDB
Motif
Pfam: Tap-RNA_bind NTF2
Other DBs
NCBI-GeneID: 109376052
NCBI-ProteinID: XP_019487263
LinkDB
Position
Un
AA seq 584 aa
MPLPSDNIMGHNTQDMTLRGRPRGRSMYRERYNYGSQHVRSGIHPSFHQQQDGNSATSGM
HMGTRIRHAPYAIPCYHQRGNFQKHDQTHVNMEKEQKPLERMEEQKRDETSGSWFKIIIP
FGIRYDEKWLLNLIQKQCSVPFTPVEFHYEKMQAQFFVENASIAFALKNVNGKIWDEDNE
KIFVIIHPSDAPQSVQKKLKSEKAEQIKLTVNKQYGVSQDSLDIQRLHFDPELMTCDTET
APNPRICMAVSLLIDEENITKERTXVNPAGQLAKGKVLEPEEMSANRNRLCTTIPDKSTN
ISSILELFPKLLCLDGQEPTPPTNFGVEAHKKLPTCKGSFFGSDALKSLVLQFLQQYYLI
HDSGDRQGLLTAYHDEACFSLTIPFNPEDRAPSSLFEYFKDNRNMKSLKDPYLRVQQLKY
TKRDIVCSLCVLPNTQHDLLSFVVDLWFQTEKMLCFSVNGLFKEVGKNYQGSVRAFSRTF
IITPASNSSLCVVNDELFVRDTTPRETQSAFSIQVPKPISSSGPTLSQEQEMVQAFSTQP
GMSSSVLRSAFMTTTGNYTGVAQVLSLPKVRSGNSGQESGTRVA
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgccactgccttcagacaacatcatggggcacaatacccaagatatgaccttacgagga
agaccaagaggcaggagtatgtacagagagaggtataactatgggtctcaacatgtccgt
tccggaattcatccttcattccaccagcagcaagatggaaattcagcaacaagtggcatg
cacatgggcacccgaataagacatgctccctatgccattccatgctatcatcagagaggc
aattttcagaaacatgaccaaacccatgttaacatggagaaggagcaaaagcctctggag
agaatggaggagcagaagcgggatgagacctcagggagctggttcaagatcattattcca
ttcggcataagatatgatgagaagtggctgctgaatttgattcagaagcagtgcagtgtc
cccttcaccccggttgaatttcactacgagaaaatgcaggcccagttcttcgttgagaat
gccagcattgccttcgcgttgaagaatgtcaatggcaagatttgggatgaagataatgag
aagatatttgtgattatccacccctctgatgcaccgcagtctgtgcagaaaaagctgaag
tcagaaaaggcagagcagataaagctaacggtgaacaaacaatatggtgtctcccaggat
tctcttgacatccaaagactccactttgacccagaattgatgacctgtgatactgaaaca
gcaccaaatcctagaatctgcatggctgtctccctgctgatcgatgaagagaacatcacc
aaagagaggacctaggtgaaccctgcagggcagttggccaagggcaaagtgctggagcca
gaggagatgagtgcaaacaggaaccgtctatgcaccaccatcccagataagtcaaccaac
ataagctccatcctggaattgttccccaagttactatgtctggatggccaggaaccaacc
ccacccactaactttggtgtggaagcccacaagaagttaccaacctgcaagggaagcttc
tttggatctgacgcgctgaagagtctagtcctgcaattcctgcagcagtattacttgatc
catgactctggagaccgacagggtctcctcactgcttatcacgacgaagcctgcttctcc
ctgaccattcccttcaaccccgaggaccgagccccaagcagcttgtttgagtacttcaag
gataacaggaatatgaagagcctcaaggacccctacctgcgggttcagcagctgaagtat
acaaaacgtgacattgtgtgctccctctgtgtgttgcccaacactcagcatgacctcctc
tccttcgtggtggacttatggttccagacggagaagatgctctgcttctctgtcaacggg
ctgttcaaggaagtgggaaaaaattatcagggttctgtgcgtgccttcagccggaccttc
atcattacccctgccagcaattccagtctatgtgtcgtgaatgatgagctgtttgtgagg
gacaccacccccagggagactcagagtgcattctccatccaagtgccgaaacccatctca
agctccgggcccaccctctcccaggagcaggaaatggtgcaggctttctccacccagcct
gggatgagctccagtgtcctcagaagtgccttcatgaccacgactgggaactacaccgga
gttgcacaggtgctctctctgcccaaggtgaggtctgggaattcaggccaagagagtgga
acccgggtggcctga

KEGG   Hipposideros armiger (great roundleaf bat): 109377472
Entry
109377472         CDS       T04661                                 

Definition
(RefSeq) nuclear RNA export factor 2-like
  KO
K14284  nuclear RNA export factor
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03008  Ribosome biogenesis in eukaryotes
hai03013  RNA transport
hai03015  mRNA surveillance pathway
hai05014  Amyotrophic lateral sclerosis
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109377472
   03015 mRNA surveillance pathway
    109377472
   03008 Ribosome biogenesis in eukaryotes
    109377472
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109377472
  09172 Infectious disease: viral
   05164 Influenza A
    109377472
   05168 Herpes simplex virus 1 infection
    109377472
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109377472
   03009 Ribosome biogenesis [BR:hai03009]
    109377472
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     109377472
   mRNA cycle factors
    Stress granule specific factors
     109377472
Ribosome biogenesis [BR:hai03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109377472
SSDB
Motif
Pfam: Tap-RNA_bind NTF2 TAP_C LRR_8
Other DBs
NCBI-GeneID: 109377472
NCBI-ProteinID: XP_019489369
LinkDB
Position
Un
AA seq 650 aa
MSPNSSSSQPGTCSHSGQAALGAASSGLPDQLGRTRHRAQKAAPRKTKARNRQEAQIRNN
FGKEKLHYEHGGYAPXPSHLQKDXGNVVMRDSQKDPQVRVDDQAAWFAIPSPNFHPNNSS
VKWCNEYEDRTPPERQMENKQDGTLGEWFKITIPYGMKYDKIWLINSIESHCSVPFTPVD
FHYANNRARFSLQGASTASALRDVSYKICNEKNQNIPIFVNTSVVPYSVWDKLKTREMEW
LKLTVNKRYDVSQKALDLHKLCYYPDLVGLDIDIILNRRNCMAATLQIIKKNFXELLSLN
LCKNKLYQLNGLSDIIQMASTVKILNLSRNELKLACELDKMKGLKLEELWLEGNPLCSTF
PDQSTYISAIRKYFPKLLHLDGQKLPPPIVTDIVGLEIIKPCKESYRGSETLKNLVFQFL
LQYYLIYDYGDRQSLLSAYHDKACFSLTIPFNPEDPALSSLLEYFKNSRNMKAVKDHDLQ
VQLLKHGKCDIVDSLSALPKTQHDLNSYVVDLCVQTEMMLCFSVNGMFKEVEVKSQESVR
AFTRTFILTFGSNSSLCIVNDELIVGKARTKETQSALSIPVPTSTSISMRSLFADQQEMV
QVISTQSGMNLQLSQKCPWDKQXNXTRAGQVFTMLKTNGQIPVEAFKQIL
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgtccccaaactcctcgtcctcgcagcctgggacctgcagccacagcggacaggccgct
ctgggggccgcctcctcgggtcttccggaccaactcgggaggactcggcatcgcgcgcag
aaggcggcgccgaggaagacaaaggcgcggaatcgccaggaggcgcagatccgaaacaat
tttggcaaggagaaacttcattatgaacatggtggatatgcgccttagccttcccacctt
cagaaggatngaggaaatgtggtgatgcgagattctcagaaggacccccaagtaagagta
gatgaccaggcagcctggtttgcaataccctctcctaatttccaccccaacaatagcagt
gtgaaatggtgtaatgaatatgaagatagaactcctccagaaagacaaatggaaaacaag
caggatggaaccctgggggaatggttcaagatcaccattccttatgggatgaagtatgac
aagatatggctaataaattcaatcgagagccattgcagtgtccccttcactccagtggat
ttccactatgcaaacaaccgagccaggttctctctccagggtgctagcactgcctctgca
ttgagggatgtcagctacaagatttgtaatgagaagaaccaaaatatacctatctttgtg
aatacttctgttgtaccctactctgtgtgggataagttgaagacaagggaaatggagtgg
ctaaagctgaccgtgaacaagagatatgatgtctcccagaaagctcttgaccttcataag
ctctgttattacccagacttggtaggccttgatattgatataatcctgaatcgaagaaac
tgcatggctgccaccctgcagatcatcaaaaagaatttctgagagctgctgtccttgaac
ttgtgcaagaacaaactgtaccagctgaatggcctgtctgacattatacagatggcctcc
acagttaagatcctgaacctctccagaaatgagctaaagttggcatgtgaattggataag
atgaaagggctgaagctcgaagagctgtggctggaagggaaccccttgtgcagcaccttc
ccagaccagtccacctacatcagtgccatcaggaaatatttccccaagttgttacacttg
gatggccaaaagttacccccaccaattgtaactgacattgtaggcctagagataataaaa
ccctgtaaggaaagctatagaggatctgagaccctgaagaatttagtctttcaattcttg
cttcagtattacttgatctatgattatggagaccgacagagtctccttagtgcttatcac
gacaaagcctgcttctccctgaccattcccttcaaccccgaggacccagccctaagcagc
ttacttgagtacttcaagaatagcaggaatatgaaggcagtcaaggatcatgacctgcag
gttcagctgctgaagcacggaaagtgtgacattgttgactccctcagtgcattgcccaaa
actcagcatgatcttaattcctatgttgtagacctgtgtgtccagacggaaatgatgctc
tgtttttctgtcaatgggatgttcaaggaagtggaagtaaagtctcaagagtctgtccgt
gccttcacccgaaccttcatcttgacttttggcagcaattccagtctgtgcatcgtgaac
gatgaactgattgtgggtaaggccaggacaaaagaaacccagagtgccttatccattcca
gtacccacatccacctccatctccatgcgcagcctcttcgcggatcagcaagaaatggtg
caggttatctccacccagtctgggatgaacctgcagttgtctcagaagtgcccttgggac
aaacagtagaactaaaccagggctggtcaggtcttcactatgctcaagaccaacggccag
atcccagtggaggccttcaaacaaatactctaa

KEGG   Hipposideros armiger (great roundleaf bat): 109384235
Entry
109384235         CDS       T04661                                 

Gene name
NXF1
Definition
(RefSeq) nuclear RNA export factor 1
  KO
K14284  nuclear RNA export factor
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03008  Ribosome biogenesis in eukaryotes
hai03013  RNA transport
hai03015  mRNA surveillance pathway
hai05014  Amyotrophic lateral sclerosis
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109384235 (NXF1)
   03015 mRNA surveillance pathway
    109384235 (NXF1)
   03008 Ribosome biogenesis in eukaryotes
    109384235 (NXF1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109384235 (NXF1)
  09172 Infectious disease: viral
   05164 Influenza A
    109384235 (NXF1)
   05168 Herpes simplex virus 1 infection
    109384235 (NXF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109384235 (NXF1)
   03009 Ribosome biogenesis [BR:hai03009]
    109384235 (NXF1)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     109384235 (NXF1)
   mRNA cycle factors
    Stress granule specific factors
     109384235 (NXF1)
Ribosome biogenesis [BR:hai03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109384235 (NXF1)
SSDB
Motif
Pfam: Tap-RNA_bind NTF2 TAP_C LRR_4 LRR_8
Other DBs
NCBI-GeneID: 109384235
NCBI-ProteinID: XP_019500966
LinkDB
Position
Un
AA seq 617 aa
MADGGKSYNEHDDRVNFPQRRKKGRGPFRWKCDGNRRSGRGGAGIRSSHLEEDDRDVAMS
DAQDVPRVRYNPYAARTNRRGDNWHDRDRIHVTVRRDRAPPQRGGAGTSQDGTSKNWFKI
TIPYGKKYDKSWLLNMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDQ
ENRRISIIINSSPPPLTIQNELKPEQIEQLKLIMSKQYDGSQQALDLKGLRSDPDLVAQN
IDVVLNRRSCMVAILKIIEENIPELLSLNLSSNKLYRLDDMSSIVQKAPNLKILNLSGNE
LKSERELDKVKGLKLEELWLEGNPLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF
DIDTPTTLPPCKGSYFGTETLKNLVLHFLQQYYAIYDSGNRQRLLDAYHDGACCSLSIPF
TPQNPARSNLSEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDINSFVVD
ISAQTNTLLCFSVNGVFKEVDGKSRDSLRAFTRTFVAVPASNSGLCIVNDELFVRNASAD
EIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQA
FTLLKGKGEIPEVAFMK
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggcggacggggggaagtcatacaatgagcacgatgatcgagttaatttccctcaaaga
agaaagaaaggccggggtcctttccggtggaagtgtgacgggaaccgtaggtctggaaga
ggaggtgctggcatccgatcttcccaccttgaagaagatgacagagatgtggcaatgagt
gatgcccaggatgttccccgagtacgatacaacccctatgctgcacgaactaaccgtcgg
ggcgataattggcatgatcgagaccgcattcatgttactgtgcggagagacagagctcct
ccacagagaggaggggctggcaccagccaggacgggacctcaaaaaactggtttaagatt
acaattccttatggcaaaaaatatgacaaatcatggcttctcaatatgattcagagcaag
tgcagtgtccctttcacccccattgagtttcactatgaaaatacacgggcccagtttttt
gttgaggatgccagtaccgcctctgcattgaaggctgttaactataagattttggatcaa
gagaaccgaaggatatccatcatcatcaactcctccccgccgcccctcactatacagaac
gaactgaagccagagcaaatagagcagctaaagctgatcatgagcaaacaatacgatggc
tcccaacaagcgcttgacctcaagggcctccgttcagacccagatttggtggcccagaat
attgatgttgtcctgaatcgtagaagctgcatggtggcgatcctgaaaatcattgaggag
aatatccctgagttattgtccttgaacttgagtagtaataagctatataggctggatgac
atgtccagcattgtgcagaaggcacccaatctaaagatcctaaacctctcaggaaatgag
ttgaagtctgaacgagaattggacaaggtgaaagggctgaagctagaagagctgtggctt
gaaggaaaccccctgtgcgacaccttccgagaccagtccacctatatcagcgccattcgc
gaacgatttccaaaattattacgcctggacggccatgagttacccccaccaattgccttt
gatattgacacccctacgacgttaccaccctgcaagggaagctattttggaacagagacc
ctgaagaatctggtcttgcacttcttgcagcagtactatgcaatttatgactctggaaac
cggcagcgactcctagatgcctaccatgatggggcctgctgctccctgagcatccctttc
actccccagaaccctgcccgaagcaacttgagcgagtacttcaaggatagcaggaatgtg
aagaagcttaaagaccctaccctgcggtttcggctgctgaagcacacacggctcaatgtc
gtcgccttcctcaatgagctgcccaaaactcagcacgacatcaattccttcgtagtagac
ataagtgcccaaacaaacacgttgttgtgtttttctgtcaatggggtctttaaggaagtg
gatggaaagtcccgggattctttacgagccttcacgcggacctttgttgctgttccggcc
agcaattcagggttgtgcattgtaaacgacgagctgtttgtgcggaatgccagcgccgat
gagatccaaagagcttttgccatgcctgcgcccacgccttcctccagccccgtgcccacc
ctctccccagagcagcaggaaatgctacaggcattctctacgcagtctggcatgaacctc
gagtggtctcagaagtgccttcaggacaacaactgggactacaccagatctgcccaggcc
tttactcttctcaagggcaagggcgaaatcccagaagtggcattcatgaagtga

KEGG   Hipposideros armiger (great roundleaf bat): 109389566
Entry
109389566         CDS       T04661                                 

Gene name
NXF5
Definition
(RefSeq) nuclear RNA export factor 5
  KO
K14284  nuclear RNA export factor
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03008  Ribosome biogenesis in eukaryotes
hai03013  RNA transport
hai03015  mRNA surveillance pathway
hai05014  Amyotrophic lateral sclerosis
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109389566 (NXF5)
   03015 mRNA surveillance pathway
    109389566 (NXF5)
   03008 Ribosome biogenesis in eukaryotes
    109389566 (NXF5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109389566 (NXF5)
  09172 Infectious disease: viral
   05164 Influenza A
    109389566 (NXF5)
   05168 Herpes simplex virus 1 infection
    109389566 (NXF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109389566 (NXF5)
   03009 Ribosome biogenesis [BR:hai03009]
    109389566 (NXF5)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     109389566 (NXF5)
   mRNA cycle factors
    Stress granule specific factors
     109389566 (NXF5)
Ribosome biogenesis [BR:hai03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109389566 (NXF5)
SSDB
Motif
Pfam: Tap-RNA_bind LRR_4 LRR_8 fn3_PAP
Other DBs
NCBI-GeneID: 109389566
NCBI-ProteinID: XP_019510720
LinkDB
Position
Un
AA seq 383 aa
MENTQDGTLEDWFKITIPYEIKYDKIWLVNSIQNHCSVPFTPVDFHYANNQARFFAQGAS
TASALKDVSCKIHDNANQKIAIFVNTSAVPYSVQNKLESKETEQLKLTMNKXYDVSQXAL
DLHKLHFDPDLVGPDIDIILNQRNCMAATLQIIKKNFPELLLLNLYKNKPCQLNGLSDII
QLAPTVKMLNLSKNQLKSVCELDKMKGLKLKELWLEGNPLHSTFPDQSTYINVIGKCFPI
XLHLDGQELPLPIVIDIVDLEIIKPCKASYRGSETLKKLVFQFLLHSLCEYFRGSRNMKK
VKDRDLWVQLLKHRKHDIVDSLSALPKPQHDLNSYVVDLCVQTKTMLCFSVNGVEEKSQG
SVHCLHPNLHLDFWQQFQSVHRE
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggaaaacacacaggatggaactctggaggactggttcaagatcacaattccttatgag
attaagtatgacaagatatggctagtgaattcaatccagaaccattgcagtgtccccttc
acgccagtggatttccactatgcaaacaaccaggcccggttctttgcccagggtgccagt
actgcctctgcattgaaggatgtcagctgtaagattcatgataacgcaaatcaaaagata
gctatctttgtcaatacttctgccgtaccctactctgtgcagaataagttggagtcaaag
gaaacggagcagctaaagctgaccatgaacaaatgatacgatgtctcccagtaagctctt
gaccttcataagctccactttgacccagacttggtgggccctgatattgatataatccta
aatcaaagaaactgcatggctgccaccctgcagatcatcaaaaagaatttccctgagctg
ttgcttttgaacttgtacaaaaacaaaccatgccagctgaatggcctgtctgacatcata
cagttggctcccacagtcaagatgctgaacctctccaaaaaccagctgaagtcggtatgc
gagttggacaagatgaaagggctgaagctcaaagagctgtggctggaagggaaccccttg
cacagcaccttcccagaccagtccacctacataaatgtcattgggaaatgtttccccatt
nagttacacctggatggccaggagttaccgctaccaattgtaattgacattgtagaccta
gagataataaaaccttgtaaggcaagctatagaggatctgagaccctgaagaagctagtc
tttcaattcctgcttcacagcttgtgtgagtacttcaggggtagcaggaatatgaagaaa
gtcaaggatcgtgacctgtgggttcagctgctgaagcacagaaagcatgacatcgttgac
tccctcagtgcattgcccaaacctcagcatgaccttaactcctatgtggtagacctatgt
gtccagacaaaaacgatgctctgtttttctgtcaatggggtagaagaaaagtctcaaggg
tctgtccattgccttcacccgaaccttcatcttgacttctggcagcaattccagtctgtg
catcgtgaatga

DBGET integrated database retrieval system