KEGG   Hipposideros armiger (great roundleaf bat): 109376143Help
Entry
109376143         CDS       T04661                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00512  Mucin type O-glycan biosynthesis
hai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    109376143 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hai01003]
    109376143 (GALNT9)
Enzymes [BR:hai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     109376143 (GALNT9)
Glycosyltransferases [BR:hai01003]
 O-Glycan biosynthesis
  Mucin-type
   109376143 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ricin_B_lectin Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 109376143
NCBI-ProteinID: XP_019487454
LinkDB All DBs
Position
Un
AA seq 541 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRLQDRSEGLVQMVRSADRRVRSRLGKAGALVD
REAILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGMAATLRDDSQEAEGKYEEYGY
NAQLSNRISLDRTIPDYRPKKCRQMTYSDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
SQLLKEVILVDDNSDSVELKFNLDQYVNKRYPGLVKIVRNSRREGLIRARLQGWKVATAP
VVGFFDAHVEFSTGWWPLEWGDSLVQAVVNFTPGHGCISARVPRTCPLAPGLPVPQQVWQ
CGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDGFKSHVYMAWNIPMTN
PGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRTYNDTLTYGEVRNSKASGYCLDQGA
EDDDRAILYPCHGMSSQLVRYSAEGLLQLGPLGSTSFLPDSKCLVDDGRTRTPALKKCED
VARPAQRLWDFTQSGPIVSRDTGRCLEVELSKDANFGLRLVMQRCSGQKWTIRNWIKRGR
H
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccaggaagatcaaaactttgctgacggtcaacatcctggtgttcgtgggc
atcatcctcttctccgtgtactgccgcctgcaggaccgctccgaggggctggtgcagatg
gtgcgcagcgctgaccgccgggtgcgcagtcggctgggcaaggcgggcgcgctggtggac
cgcgaagccatcctgcagcgcctggaccacctggaggaggtggtctacaaccagctgaac
ggcctcgccaagcccatgggtctggtggaggggccggggggcctgggccagggtggcatg
gcagccacgctgcgggacgacagccaggaggcggagggcaagtatgaagaatacggctac
aacgcacagctcagcaaccgcatctcgctggacaggaccatccccgactacaggcccaaa
aagtgcagacagatgacctactcagacgacctgccccagatctccgtggtcttcatcttc
gtcaacgaggccctgtcggtcatcctgcgctccgtccacagcgtggtcaaccacacgccc
tcccagctgctcaaggaggtcatcctggtggacgacaacagtgacagcgtggagctcaag
ttcaacctggaccagtacgtcaacaagaggtacccgggcctggtgaagatcgtccgaaac
agcaggcgagaaggcctgatccgggcgcggctgcagggctggaaggtggccacggccccc
gtcgtcggcttctttgacgcgcacgtggagttcagcaccggctggtggcccttggaatgg
ggagacagccttgtccaggctgtggtgaacttcacgcccggccatggctgcatttccgcc
cgtgtcccccggacgtgcccactggcaccaggcctcccggtgccccagcaggtgtggcag
tgtggtggcagcatggaggtgctgccctgctcccgcgtggcacacatcgaacgcaccaag
aagccctacaacaacgacatcgattactacgccaagcgcaacgccctgcgggcggccgag
gtgtggatggacggcttcaagtcccatgtgtacatggcctggaacattcccatgacaaac
ccaggagtggactttggggacgtgtccgaacggctggccctgcgccagaggctgaaatgt
cgcagcttcaagtggtacctggagaacgtgtaccctgagatgaggacttacaacgacacc
ctcacgtacggagaggtgagaaacagcaaagccagcggctactgcttggaccagggagca
gaggacgacgaccgagcaatcctctacccatgccacgggatgtcctcccagctggtgcgc
tacagcgcggagggtctgctgcagctcggacccctgggctccacatccttcctgcccgac
tccaagtgcctggtggatgacggcaggacccgcacccccgccctgaagaagtgcgaggac
gtggcccggccagcccagcggctgtgggacttcacccagagcggccccatcgtgagccga
gacactggcaggtgcctggaggtggagctgtccaaggatgccaacttcgggctgcggctg
gtgatgcagagatgctcggggcagaagtggaccatcagaaactggatcaagcgtgggagg
cactga

DBGET integrated database retrieval system