KEGG   Hipposideros armiger (great roundleaf bat): 109376384Help
Entry
109376384         CDS       T04661                                 

Definition
(RefSeq) anionic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04080  Neuroactive ligand-receptor interaction
hai04972  Pancreatic secretion
hai04974  Protein digestion and absorption
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109376384
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    109376384
   04974 Protein digestion and absorption
    109376384
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    109376384
Enzymes [BR:hai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     109376384
Peptidases [BR:hai01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109376384
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109376384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 109376384
NCBI-ProteinID: XP_019487847
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MNPLLIFAFVGVAVAFPADDDDKIVGGYTCQENSVPYQVSLNAGYHFCGGSLINDQWVVS
AAHCYKSRIQVRLGEHNIDVLEGNEQFINSAKVIRHPGYDSWTLDNDIMLIKLSSPAVIS
ARVSTVSLPSACAPAGTQCLISGWGNTLSSGVNYPELLQCLEAPLLSQAKCEASYPGQIT
ENMVCAGFLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAQKNRPGVYTRVCKFVDWIQ
ETIANNS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatctttgcctttgtgggagttgccgttgctttccccgctgacgac
gatgacaagatcgtcgggggctacacctgccaggagaactccgtcccctaccaggtgtcc
ctgaatgctggctaccacttctgcggtggctccctcatcaatgaccagtgggtggtgtcc
gcggctcactgctacaagtcccgtatccaggtgaggctgggagagcacaacatcgatgtc
ctggagggcaacgagcagttcatcaactctgccaaggtcatccgccaccccggctatgac
agctggaccctggacaatgacatcatgctgatcaagctgtcctcgcctgccgtcatcagt
gcccgggtgtccaccgtctccctgccttcagcctgtgcgcccgctggcacccagtgcctc
atctccggctggggcaacaccctgagctctggcgtcaactaccctgagctgctgcagtgc
ctggaagcccctctgctgagccaggccaagtgcgaagcctcttaccccggacagatcaca
gagaacatggtctgcgctggcttccttgagggaggcaaggactcctgccagggtgactct
ggtggccccgtggtctgcaatggggagctccaaggagtcgtctcctggggctacggctgc
gcccagaagaacaggcctggtgtctacaccagagtctgcaaatttgtggactggattcag
gagaccatcgccaacaacagctaa

DBGET integrated database retrieval system