KEGG   Hipposideros armiger (great roundleaf bat): 109376563
Entry
109376563         CDS       T04661                                 

Gene name
ARAF
Definition
(RefSeq) A-Raf proto-oncogene, serine/threonine kinase
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04068  FoxO signaling pathway
hai04270  Vascular smooth muscle contraction
hai04650  Natural killer cell mediated cytotoxicity
hai04720  Long-term potentiation
hai04726  Serotonergic synapse
hai04730  Long-term depression
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04928  Parathyroid hormone synthesis, secretion and action
hai05010  Alzheimer disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05034  Alcoholism
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109376563 (ARAF)
   04012 ErbB signaling pathway
    109376563 (ARAF)
   04068 FoxO signaling pathway
    109376563 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109376563 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109376563 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109376563 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    109376563 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    109376563 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109376563 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    109376563 (ARAF)
   04720 Long-term potentiation
    109376563 (ARAF)
   04730 Long-term depression
    109376563 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109376563 (ARAF)
   05205 Proteoglycans in cancer
    109376563 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109376563 (ARAF)
   05212 Pancreatic cancer
    109376563 (ARAF)
   05225 Hepatocellular carcinoma
    109376563 (ARAF)
   05226 Gastric cancer
    109376563 (ARAF)
   05214 Glioma
    109376563 (ARAF)
   05221 Acute myeloid leukemia
    109376563 (ARAF)
   05220 Chronic myeloid leukemia
    109376563 (ARAF)
   05218 Melanoma
    109376563 (ARAF)
   05211 Renal cell carcinoma
    109376563 (ARAF)
   05219 Bladder cancer
    109376563 (ARAF)
   05215 Prostate cancer
    109376563 (ARAF)
   05213 Endometrial cancer
    109376563 (ARAF)
   05224 Breast cancer
    109376563 (ARAF)
   05223 Non-small cell lung cancer
    109376563 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109376563 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    109376563 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    109376563 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109376563 (ARAF)
   05160 Hepatitis C
    109376563 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109376563 (ARAF)
   01522 Endocrine resistance
    109376563 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109376563 (ARAF)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109376563 (ARAF)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   109376563 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 109376563
NCBI-ProteinID: XP_019488098
LinkDB
Position
Un
AA seq 606 aa
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTSWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSVQDLSVASRQHETPSNRPPNEPL
TPQGPSSCTQHHDPEHFPFSTPANAPLQRIRSTSTPNVHMVSTTAPMDSSLIQLTTQSFN
TDAAGSRGGGDGAPRGSPSPASVSSGRKSPHSKSPSEQRERKSLADDKKKVKNLGYRDSG
YYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRK
TRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL
HAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRM
QDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKISSNCPK
AMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLS
AARLVP
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaacggggccgagccgtcccgggcagtgggcact
gtcaaagtgtacctgcccaacaagcaacgcacagtagtgactgtccgggatggcatgagt
gtctatgactctttagacaaggccctcaaggtgcggggtctcaatcaggattgctgcgtg
gtctaccggctcatcaaggggcgaaagacagtcacttcctgggacacagccattgccccc
ctggatggcgaggagctcattgtggaggtcctcgaagatgtccctctgaccatgcacaat
tttgtacggaagacattcttcagcctggcgttctgtgacttctgccttaagtttctgttc
catggcttccgctgccaaacctgtggctacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgttgacatgagtaccaaccgccgacagttctaccacagtgtccaggat
ttgtccgtagcctccagacagcatgagactccctcgaaccgccccccgaatgagccgcta
acccctcagggtcccagctcctgtacccagcaccatgaccctgagcacttccccttctct
accccggctaatgcccccctccagcgcatccgctccacgtccacccccaacgtccatatg
gttagcaccacagcccccatggactccagcctcatccagctcacgacccagagtttcaac
actgatgctgctggtagtagaggtggtggtgatggagcaccccgggggagccccagtccg
gctagcgtgtcctcggggaggaagtccccacattccaagtccccatcagaacaacgggag
cggaagtccttggctgatgataagaagaaagtgaagaatctggggtaccgggactcgggc
tattactgggaggtgccacccagtgaggtgcagctgctgaagaggatcgggacgggctcg
tttggaaccgtgtttcgcgggcggtggcatggcgatgtggctgtgaaggtgctcaaggtg
gcccaacccacagctgagcaagcccaggccttcaagaacgagatgcaggtgctcaggaag
acacgacacgtcaacatcttgctgttcatgggcttcatgacccggcctgggttcgccatc
atcacacagtggtgtgagggctccagtctctaccaccacctccatgttgccgacacacgt
tttgacatggtccagctcatagatgtggcccggcagactgcccagggcatggactaccta
catgccaagaacatcatccatcgagacctcaagtcgaacaacatctttttacacgaggga
ctcacagtgaagatcggtgattttggcctggccacagtgaagacgcggtggagcggggct
cagcccttggagcagccgtcaggctctgtgctgtggatggcggctgaagtgatccgtatg
caggacccgaacccctacagcttccagtcagatgtctacgcctatggggttgtgctgtat
gagctcatgactggctccctgccttatagccacattggcagccgtgaccagattatcttt
atggtgggccgtggctatctgtccccggacctcagcaaaatctccagcaactgccccaag
gccatgcggcgcctgctgtctgactgcctcaagttccagcgggaggagcggcccctcttc
ccccagatcctggccacgattgagctgctgcagcggtcactccccaagattgagcggagt
gcctccgaaccctccttgcaccgcacccaggctgatgagttacccgcctgcctactcagc
gcagcccgccttgtgccttag

KEGG   Hipposideros armiger (great roundleaf bat): 109384548
Entry
109384548         CDS       T04661                                 

Gene name
RAF1
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04068  FoxO signaling pathway
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04218  Cellular senescence
hai04270  Vascular smooth muscle contraction
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04371  Apelin signaling pathway
hai04510  Focal adhesion
hai04540  Gap junction
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04613  Neutrophil extracellular trap formation
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04726  Serotonergic synapse
hai04730  Long-term depression
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04912  GnRH signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04916  Melanogenesis
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04921  Oxytocin signaling pathway
hai04926  Relaxin signaling pathway
hai04928  Parathyroid hormone synthesis, secretion and action
hai04929  GnRH secretion
hai04935  Growth hormone synthesis, secretion and action
hai05010  Alzheimer disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05034  Alcoholism
hai05132  Salmonella infection
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109384548 (RAF1)
   04012 ErbB signaling pathway
    109384548 (RAF1)
   04014 Ras signaling pathway
    109384548 (RAF1)
   04015 Rap1 signaling pathway
    109384548 (RAF1)
   04370 VEGF signaling pathway
    109384548 (RAF1)
   04371 Apelin signaling pathway
    109384548 (RAF1)
   04630 JAK-STAT signaling pathway
    109384548 (RAF1)
   04068 FoxO signaling pathway
    109384548 (RAF1)
   04072 Phospholipase D signaling pathway
    109384548 (RAF1)
   04071 Sphingolipid signaling pathway
    109384548 (RAF1)
   04024 cAMP signaling pathway
    109384548 (RAF1)
   04022 cGMP-PKG signaling pathway
    109384548 (RAF1)
   04151 PI3K-Akt signaling pathway
    109384548 (RAF1)
   04150 mTOR signaling pathway
    109384548 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109384548 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    109384548 (RAF1)
   04218 Cellular senescence
    109384548 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109384548 (RAF1)
   04540 Gap junction
    109384548 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    109384548 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109384548 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    109384548 (RAF1)
   04625 C-type lectin receptor signaling pathway
    109384548 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    109384548 (RAF1)
   04660 T cell receptor signaling pathway
    109384548 (RAF1)
   04662 B cell receptor signaling pathway
    109384548 (RAF1)
   04664 Fc epsilon RI signaling pathway
    109384548 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    109384548 (RAF1)
   04062 Chemokine signaling pathway
    109384548 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109384548 (RAF1)
   04929 GnRH secretion
    109384548 (RAF1)
   04912 GnRH signaling pathway
    109384548 (RAF1)
   04915 Estrogen signaling pathway
    109384548 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    109384548 (RAF1)
   04917 Prolactin signaling pathway
    109384548 (RAF1)
   04921 Oxytocin signaling pathway
    109384548 (RAF1)
   04926 Relaxin signaling pathway
    109384548 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    109384548 (RAF1)
   04919 Thyroid hormone signaling pathway
    109384548 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    109384548 (RAF1)
   04916 Melanogenesis
    109384548 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109384548 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    109384548 (RAF1)
   04720 Long-term potentiation
    109384548 (RAF1)
   04730 Long-term depression
    109384548 (RAF1)
   04722 Neurotrophin signaling pathway
    109384548 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    109384548 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109384548 (RAF1)
   05206 MicroRNAs in cancer
    109384548 (RAF1)
   05205 Proteoglycans in cancer
    109384548 (RAF1)
   05230 Central carbon metabolism in cancer
    109384548 (RAF1)
   05231 Choline metabolism in cancer
    109384548 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109384548 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109384548 (RAF1)
   05212 Pancreatic cancer
    109384548 (RAF1)
   05225 Hepatocellular carcinoma
    109384548 (RAF1)
   05226 Gastric cancer
    109384548 (RAF1)
   05214 Glioma
    109384548 (RAF1)
   05221 Acute myeloid leukemia
    109384548 (RAF1)
   05220 Chronic myeloid leukemia
    109384548 (RAF1)
   05218 Melanoma
    109384548 (RAF1)
   05211 Renal cell carcinoma
    109384548 (RAF1)
   05219 Bladder cancer
    109384548 (RAF1)
   05215 Prostate cancer
    109384548 (RAF1)
   05213 Endometrial cancer
    109384548 (RAF1)
   05224 Breast cancer
    109384548 (RAF1)
   05223 Non-small cell lung cancer
    109384548 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109384548 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    109384548 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    109384548 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109384548 (RAF1)
   05152 Tuberculosis
    109384548 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109384548 (RAF1)
   05161 Hepatitis B
    109384548 (RAF1)
   05160 Hepatitis C
    109384548 (RAF1)
   05164 Influenza A
    109384548 (RAF1)
   05163 Human cytomegalovirus infection
    109384548 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109384548 (RAF1)
   05165 Human papillomavirus infection
    109384548 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109384548 (RAF1)
   01522 Endocrine resistance
    109384548 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109384548 (RAF1)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109384548 (RAF1)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   109384548 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 109384548
NCBI-ProteinID: XP_019501535
LinkDB
Position
Un
AA seq 668 aa
MEHIQGAWKTISNGFGLKDAVFDGPSCISPTIVQQFAYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDMCQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNVRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPISSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTMPVDSRMIENNSLNASPRAWSRRFCLRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcttggaagacgatcagtaatggttttggactcaaagacgca
gtgtttgatggccccagctgcatttctcccacaatagttcagcagttcgcctatcagcgt
cgggcgtcagatgatggcaaacttacggactcttcgaagacaagcaatactatccgtgtt
ttcttgccaaacaagcaaagaacagtggtcaatgtacgaaatggaatgagcttgcatgac
tgccttatgaaagcactcaaagtgaggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaaaggtaaaaaagcacgtttagattggaatactgatgctgcctca
ttgattggagaagaacttcaagtagatttcctggatcatgttcccctcacaacacacaac
tttgctcggaagaccttcctgaagcttgccttctgtgacatgtgtcagaagttcctgcta
aatggatttcgatgtcagacttgtggctacaaatttcacgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatgtcagacaactcttattgtttccaaattccacc
attggcgatagcggggtcccagcactgccttctttgacaatgcgcaggatgcgagagtct
gtttcccggatgcctattagttcccagcacagatactccacaccccacgccttcacgttc
aacacctccagcccctcctctgaaggttccctctctcagaggcagaggtcgacatccaca
cctaatgtccacatggtcagcaccaccatgcctgtggacagcaggatgattgagaataac
agcctgaatgcttctcccagggcgtggtccagacgattttgtttgaggggaagagatgca
attcgaagtcacagtgaatcagcctcaccttcagccttgtccagcagccccaacaatctg
agcccaacaggctggtcacagcccaaaacccctgtgccggcacagagagagcgggcacca
ggatccgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctccactcggattggatcaggctccttt
ggaactgtttataagggcaagtggcatggagacgttgcagtcaagatcctaaaggttgtc
gaccccacaccagagcagttccaggccttcaggaacgaggtggccgtcctgcgcaaaacg
cggcacgtgaacatccttctcttcatggggtacatgacgaaggacaacctggcgattgtg
acccagtggtgtgagggcagcagcctctacaaacacctgcatgtccaagagaccaagttc
cagatgttccagttgattgacatcgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaattggagattttggtttggcaacagtcaagtcacgctggagtggttctcag
caggtggagcaacctaccggctctgtcctgtggatggcccccgaggtgatccgaatgcag
gataataacccgttcagcttccagtccgatgtctactcctatggcattgtgctgtatgag
ctcatgacaggggagctaccttactcccacatcaacaaccgggatcagatcatcttcatg
gtgggccgagggtatgcctccccagaccttagtaagctatataagaactgccccaaagca
atgaagaggcttgtcgctgactgtgtgaagaaagttaaggaagagaggcctcttttcccc
cagatcctgtcttccattgaactgctccaacactctctaccgaaaatcaaccggagcgct
tctgagccatccctgcaccgggcggcccacactgaggatatcaatgcctgcacgctgacc
acgtccccgagactgcctgtcttctag

KEGG   Hipposideros armiger (great roundleaf bat): 109395605
Entry
109395605         CDS       T04661                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04015  Rap1 signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04068  FoxO signaling pathway
hai04150  mTOR signaling pathway
hai04270  Vascular smooth muscle contraction
hai04510  Focal adhesion
hai04650  Natural killer cell mediated cytotoxicity
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04726  Serotonergic synapse
hai04730  Long-term depression
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04928  Parathyroid hormone synthesis, secretion and action
hai04934  Cushing syndrome
hai05010  Alzheimer disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05034  Alcoholism
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109395605 (BRAF)
   04012 ErbB signaling pathway
    109395605 (BRAF)
   04015 Rap1 signaling pathway
    109395605 (BRAF)
   04068 FoxO signaling pathway
    109395605 (BRAF)
   04024 cAMP signaling pathway
    109395605 (BRAF)
   04150 mTOR signaling pathway
    109395605 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109395605 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109395605 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109395605 (BRAF)
   04062 Chemokine signaling pathway
    109395605 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109395605 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    109395605 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    109395605 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109395605 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    109395605 (BRAF)
   04720 Long-term potentiation
    109395605 (BRAF)
   04730 Long-term depression
    109395605 (BRAF)
   04722 Neurotrophin signaling pathway
    109395605 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109395605 (BRAF)
   05205 Proteoglycans in cancer
    109395605 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109395605 (BRAF)
   05212 Pancreatic cancer
    109395605 (BRAF)
   05225 Hepatocellular carcinoma
    109395605 (BRAF)
   05226 Gastric cancer
    109395605 (BRAF)
   05214 Glioma
    109395605 (BRAF)
   05216 Thyroid cancer
    109395605 (BRAF)
   05221 Acute myeloid leukemia
    109395605 (BRAF)
   05220 Chronic myeloid leukemia
    109395605 (BRAF)
   05218 Melanoma
    109395605 (BRAF)
   05211 Renal cell carcinoma
    109395605 (BRAF)
   05219 Bladder cancer
    109395605 (BRAF)
   05215 Prostate cancer
    109395605 (BRAF)
   05213 Endometrial cancer
    109395605 (BRAF)
   05224 Breast cancer
    109395605 (BRAF)
   05223 Non-small cell lung cancer
    109395605 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109395605 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    109395605 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    109395605 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109395605 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109395605 (BRAF)
   05160 Hepatitis C
    109395605 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109395605 (BRAF)
   01522 Endocrine resistance
    109395605 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109395605 (BRAF)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109395605 (BRAF)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   109395605 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 109395605
NCBI-ProteinID: XP_019522312
LinkDB
Position
Un
AA seq 818 aa
MAALSGGGGGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEH
IEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTV
TSSSSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS
LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRK
TFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPI
PQEEASLAETSLTSGSSPSAPPDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRD
RSSSAPNVHINTIEPVNIDEKFPEVELQDQRDLIRDQGFRSDGAPLNQLMRCLRKYQSRT
PSPLLHSVPSEIVFDFEPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSS
SSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTA
PTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFE
MIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQ
FEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMV
GRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSAS
EPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcggcggcggcggcgcggagcagggccaggctctg
ttcaacggggacatggagcccgaggccggcgccggcgccgcggcctcctcggctgcggac
cctgccatcccggaggaggtgtggaacatcaaacaaatgattaagttgacacaggaacat
atagaggccctattggacaaatttggtggagagcataatccaccatcaatatatctggag
gcctatgaagaatacaccagcaagctagatgccctccaacaaagagaacaacagttattg
gaatccctggggaatggaactgatttttctgtttctagctctgcatcaacggacaccgtt
acatcttcttcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaac
cccacagatgtgtcacggagcaaccctaagtcaccacaaaaacctattgttagagtcttc
ctgcccaacaaacagaggacagtggtacctgcgaggtgtggcgttacagtccgagacagt
ctaaagaaagcactgatgatgagaggtctaatcccagagtgctgtgccgtttacagaatt
caggatggagagaagaagccaattggctgggacactgatatttcctggcttaccggcgag
gagttgcatgtagaagtattggagaatgttccactgacaacacacaactttgtacggaaa
acttttttcaccttagctttttgtgacttttgtcgaaagctgcttttccagggtttccgc
tgtcaaacatgtggttataaatttcaccagcgctgtagcacagaagttcctctgatgtgt
gttaattatgaccaacttgatttgctgtttgtctccaagttctttgaacaccacccaata
ccacaggaggaggcctccttagcagagacttcccttacgtctggatcgtccccttctgca
ccccccgattctattgggccccaaattctcaccagtccgtctccttcaaaatccattcca
attccacagcctttccgaccagcagatgaagatcatcgaaatcagtttggacaacgagac
cggtcctcgtcggctccaaacgtgcatataaacacaatagaacctgtcaatattgatgaa
aaattcccagaagtggaattacaggatcaaagggacttgattagagaccaagggtttcgt
agtgatggagcccctttgaaccagctgatgcgctgtcttcggaaataccaatcccggact
cccagccccctcctccattctgtccccagtgaaatagtgtttgattttgagcctggccca
gtgttcagaggatcaaccacaggtttgtctgccacgccccctgcctcattacctggctca
ctcactaatgtgaaagcactacagaaatctccaggacctcagcgggaaaggaagtcatct
tcatcctcagaagacaggaatcgaatgaaaacacttggtagacgggattcaagtgatgat
tgggagattcctgatggccagatcacagtgggacaaagaattggatccgggtcatttggg
acagtctacaagggaaagtggcatggtgatgtcgcagtgaaaatgttgaatgtgacagca
cccacacctcagcagttacaggccttcaaaaatgaagtaggcgtactcaggaaaactcga
catgtgaatatcctactcttcatgggctattccacaaagccacaactggctattgttaca
cagtggtgtgagggctccagcttatatcaccatctccacatcattgagaccaaatttgag
atgatcaaacttatagatatcgcacggcagactgcacagggcatggattacttacacgcc
aagtcaatcatccacagagacctcaagagtaataatatttttcttcacgaagacctcaca
gtaaaaataggtgattttggtctagccacagtgaaatctcgatggagtgggtcccatcag
tttgaacagttgtctggatccatcttgtggatggcaccagaagtaatcagaatgcaagat
aaaaacccctatagctttcagtcagatgtgtatgcatttgggattgttctgtatgaattg
atgactggacagttaccttattcaaacatcaacaacagggaccagataatttttatggtg
ggacgaggatatctatctccagatctcagtaaggtacgaagtaactgtccaaaagccatg
aagagattaatggcagagtgcctgaaaaagaaaagagatgagagaccactctttccccaa
attctcgcctctattgagctgctggcccgctcattgccaaaaattcaccgcagtgcatca
gaaccctccttgaatcgggctggcttccaaacagaggactttagtctatatgcttgtgct
tctccaaaaacgcccatccaggcggggggatatggagaatttgcagccttcaagtag

DBGET integrated database retrieval system