KEGG   Hipposideros armiger (great roundleaf bat): 109376589
Entry
109376589         CDS       T04661                                 

Gene name
HNRNPUL1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein U like 1
  KO
K15047  heterogeneous nuclear ribonucleoprotein U-like protein 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109376589 (HNRNPUL1)
SSDB
Motif
Pfam: AAA_33 SPRY SAP SAP_new25 AAA_18 SRP54 Rox3
Other DBs
NCBI-GeneID: 109376589
NCBI-ProteinID: XP_019488168
LinkDB
Position
Un
AA seq 856 aa
MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPEDERELEAEDEPGRPGHN
NEEVETEGGSELEGTAQPPPPGLQPHPEPGGYSGPDGHYVMDNITRQNQFYETQVIKQEN
ESGYERRPLEVEQQQAYRPAEMKTEMKQEAPTSFLPPEASQLKPERQQFQSRKRPYEDNR
GRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGF
AYLWSGARASYGVRRGRVCFEMKINEEIAVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEP
FSYGYGGTGKKSTSSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQ
KEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLNERIRGTIGPKTKA
ECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDV
LIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLK
DRTIKRTDEEGKDVPDHAVLEMKANFTLPDAGDFLDEVLFIELQREEADKLVRQYNEEGR
KAGPPPEKRFDNRGGGGFRGRGGGGSFQRYDNRGPPGGNRGGFQNRGGGTGGGGSYRGGF
NRSGGGGYNQNRWGNNSRDNNSNNRGSYSRAPQQQPPPQQPPPPQPPPQQPPPPPSYSPA
RNPPGPGSYSKNSNIPGASASTSTPAVSSYSPPQPSYSQPPYNQGGYSQGYTAPPPPPPP
PPAYNYGSYGGYTPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY
DYGSYTGNTQGGTSTQ
NT seq 2571 nt   +upstreamnt  +downstreamnt
atggatgtgcgccgtctgaaggtgaacgaacttcgtgaggagctgcagcgccgcggcctg
gacactcgcggcctcaaggccgagcttgctgagcggctgcaggcggcgctggaggccgag
gagcccgaggacgagcgggagctcgaggccgaagacgaaccggggcgacccgggcacaac
aacgaggaggtcgagaccgaggggggctccgagctggaggggaccgcgcagccaccgccg
cccgggctgcagccgcacccggagcctggcggctactcggggccggacggacattatgtc
atggacaatattaccaggcagaaccaattctatgagacccaggtcatcaaacaagagaac
gagtcaggctatgagaggagaccgctggaagtggagcagcagcaggcctatcgcccagca
gaaatgaagacagagatgaagcaagaggcacccaccagcttcctcccgcctgaagcatct
caactcaagccagaaagacagcaattccagagtcgcaagaggccttatgaagataaccgg
ggacgggggtactttgagcaccgagaggataggaggggccgctctcctcagcctcctgct
gaagaagatgaagatgactttgacgacacccttgttgccatcgacacatataactgcgac
ctccacttcaaggtggcccgagaccggagtagtggctacccgctcacaattgagggcttt
gcatacctgtggtcaggagcccgtgccagctatggagtcagaaggggccgtgtgtgcttc
gagatgaagatcaatgaggaaatcgccgtgaagcaccttccatccacggagcctgaccca
catgtcgtccgcatcggttggtccctggactcctgcagcacccagctaggcgaagagcct
ttctcctatggctatggaggcactgggaagaagtccactagtagccggtttgaaaactac
ggagacaagtttgcagagaatgatgtgattggctgctttgcggacttcgaatgtggaaat
gacgtggaactttccttcaccaagaatgggaagtggatgggtattgctttccgaattcag
aaggaagccttagggggtcaggccctctaccctcatgtcctggtgaagaattgtgcagta
gagttcaacttcgggcagagggcagagccctactgttctgtcctccctggcttcaccttc
atccagcatcttcccctgaatgagcggatccggggcactatcggaccaaagaccaaggca
gagtgtgagattctgatgatggtgggcctgcctgctgctggtaagaccacgtgggccatt
aaacatgcagcctccaacccctccaagaagtacaatatcctgggtaccaatgccatcatg
gacaagatgcgggtgatgggcctacgtcgacagcggaactacgctggccgctgggatgtc
ctgatccagcaggccacccagtgcctcaaccgcctcatccagattgccgcccgcaagaaa
cgcaactatatcctagaccagacaaacgtttatgggtcagcccagagacgaaaaatgaga
ccttttgaaggcttccagcgcaaagctattgtcatttgtcccactgacgaggatctaaaa
gatcgaacaataaagcgaaccgatgaggaagggaaggatgtcccagatcacgcggtcctg
gaaatgaaagctaacttcacgttgccagacgctggggacttcctggatgaagtgctgttc
attgagctgcagcgggaggaagccgataagctggtgaggcaatacaatgaggaaggccgc
aaagctgggccaccccctgaaaagcgctttgataaccgaggcggcggtggcttccggggc
cgcggtggtggtggcagtttccaacgctatgacaaccgaggcccccctgggggcaaccga
ggaggcttccagaaccgagggggaggcaccggtggaggaggcagctaccgaggaggtttc
aaccgcagtggaggtggtggctacaaccagaaccgctggggtaacaacagccgggataac
aactccaacaaccgaggcagctatagccgcgctccccagcagcagccacccccacagcag
ccgccaccgccacagccgccaccgcagcagccgccgccgccgcccagctacagccctgct
cggaacccaccggggcccggcagctatagcaagaacagcaacatccctggcgccagcgcc
agcaccagcacccccgccgtcagcagctacagccctccacagccgagttacagccagcca
ccctacaaccagggaggttacagccagggctatacagccccaccacctccaccgccacct
ccacctgcctacaactatgggagctacggtggctacaccccagcaccctacaccccacca
ccgccccccaccgcacagacctaccctcagccgagctataaccagtatcagcagtatgcc
cagcagtggaaccagtactatcagaaccagggccagtggccgccgtactacgggaactac
gactacgggagctacaccgggaacacacaggggggcacgagcactcagtag

DBGET integrated database retrieval system