KEGG   Hipposideros armiger (great roundleaf bat): 109376728
Entry
109376728         CDS       T04661                                 

Gene name
NXT2
Definition
(RefSeq) nuclear transport factor 2 like export factor 2
  KO
K14285  NTF2-related export protein 1/2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03008  Ribosome biogenesis in eukaryotes
hai03013  RNA transport
hai03015  mRNA surveillance pathway
hai05014  Amyotrophic lateral sclerosis
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109376728 (NXT2)
   03015 mRNA surveillance pathway
    109376728 (NXT2)
   03008 Ribosome biogenesis in eukaryotes
    109376728 (NXT2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109376728 (NXT2)
  09172 Infectious disease: viral
   05164 Influenza A
    109376728 (NXT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109376728 (NXT2)
   03009 Ribosome biogenesis [BR:hai03009]
    109376728 (NXT2)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     109376728 (NXT2)
Ribosome biogenesis [BR:hai03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109376728 (NXT2)
SSDB
Motif
Pfam: NTF2
Other DBs
NCBI-GeneID: 109376728
NCBI-ProteinID: XP_019488368
LinkDB
Position
Un
AA seq 188 aa
MGLEKWAARQRNFFFLPNWISNIRESWPRESVETPLLTAQASPSSPMAAAVDFKTYVDQA
CRAAEEFVNIYYDTMDKRRRALPRLYLDKATLIWNGNVVSGLDALANFFDVLPASEFQVN
MLDCQPVHEQATQAQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNSTVWKIASDCF
RFQDWSSN
NT seq 567 nt   +upstreamnt  +downstreamnt
atggggttggagaagtgggcggcgcgtcagaggaattttttttttcttccaaactggatc
tcaaacatcagagagagctggccacgtgagagcgtagagactccgctactgactgcacag
gcttctcccagctccccgatggccgcggctgtggattttaaaacttatgtagatcaggca
tgtagagctgctgaggaatttgtcaatatttactatgacacaatggacaaaagaagacgg
gcactgcccaggctttatttggacaaggccactttaatatggaatggaaatgttgtttca
ggactggatgccctagctaatttttttgatgtgttgcctgctagtgaattccaggtcaat
atgttagattgccaaccagttcatgagcaagctactcaggcccagactacagttcttgtt
gtgaccagtggaactgtgaagtttgacggaaacaagcaacacttcttcaatcaaaacttc
ctgctgactgcgcagtccactccgaacagcactgtgtggaagattgcaagtgattgcttc
cgttttcaagattggtctagtaactaa

KEGG   Hipposideros armiger (great roundleaf bat): 109377530
Entry
109377530         CDS       T04661                                 

Gene name
NXT1
Definition
(RefSeq) nuclear transport factor 2 like export factor 1
  KO
K14285  NTF2-related export protein 1/2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03008  Ribosome biogenesis in eukaryotes
hai03013  RNA transport
hai03015  mRNA surveillance pathway
hai05014  Amyotrophic lateral sclerosis
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109377530 (NXT1)
   03015 mRNA surveillance pathway
    109377530 (NXT1)
   03008 Ribosome biogenesis in eukaryotes
    109377530 (NXT1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109377530 (NXT1)
  09172 Infectious disease: viral
   05164 Influenza A
    109377530 (NXT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109377530 (NXT1)
   03009 Ribosome biogenesis [BR:hai03009]
    109377530 (NXT1)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     109377530 (NXT1)
Ribosome biogenesis [BR:hai03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109377530 (NXT1)
SSDB
Motif
Pfam: NTF2 Cofilin_ADF
Other DBs
NCBI-GeneID: 109377530
NCBI-ProteinID: XP_019489451
LinkDB
Position
Un
AA seq 140 aa
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFLLTAQAS
PSNAVWKIASDCFRFQDWAS
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcatcagtggacttcaagacctacgtggatcaggcctgcagggctgccgaggagttt
gtcaatgtctactacaccaccatggataagcggcggcgtctgctgtcccgcctgtacatg
ggcacagccaccctggtgtggaatggaaatgctgtttcgggacaagagtccttgagtgag
ttttttgaaatgttgccttccagtgagttccaaatcaacgtggtagactgtcagcctgtt
catgatgaagctaccccaagccagaccacagtcctcgttgtgatctgtggaacagtgaaa
tttgaaggcaacaaacaacgagacttcaaccagaactttctcctgaccgcccaggcctcg
cccagcaatgcagtgtggaaaatagcaagtgattgtttccggttccaggactgggccagc
tag

DBGET integrated database retrieval system