KEGG   Hipposideros armiger (great roundleaf bat): 109376923
Entry
109376923         CDS       T04661                                 

Gene name
SHC3
Definition
(RefSeq) SHC adaptor protein 3
  KO
K17448  SHC-transforming protein 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04062  Chemokine signaling pathway
hai04072  Phospholipase D signaling pathway
hai04510  Focal adhesion
hai04650  Natural killer cell mediated cytotoxicity
hai04722  Neurotrophin signaling pathway
hai04910  Insulin signaling pathway
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04926  Relaxin signaling pathway
hai04935  Growth hormone synthesis, secretion and action
hai05034  Alcoholism
hai05100  Bacterial invasion of epithelial cells
hai05214  Glioma
hai05220  Chronic myeloid leukemia
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109376923 (SHC3)
   04014 Ras signaling pathway
    109376923 (SHC3)
   04072 Phospholipase D signaling pathway
    109376923 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109376923 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109376923 (SHC3)
   04062 Chemokine signaling pathway
    109376923 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109376923 (SHC3)
   04915 Estrogen signaling pathway
    109376923 (SHC3)
   04917 Prolactin signaling pathway
    109376923 (SHC3)
   04926 Relaxin signaling pathway
    109376923 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    109376923 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109376923 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109376923 (SHC3)
   05226 Gastric cancer
    109376923 (SHC3)
   05214 Glioma
    109376923 (SHC3)
   05220 Chronic myeloid leukemia
    109376923 (SHC3)
   05224 Breast cancer
    109376923 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    109376923 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    109376923 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109376923 (SHC3)
   01522 Endocrine resistance
    109376923 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 109376923
NCBI-ProteinID: XP_019488619
LinkDB
Position
Un
AA seq 459 aa
MLPRTKYNRFRNDSVTSVDDLLHNLSVSSGGKVSATRAAPAAAPYLVSGDALRKAPDDGP
GSLGHLLHKVSHLKLSSSGLRGLSAARERAGARLSGSCSAPSLAAPDGSSSPGPRAPAMR
AARKGRSSDEPPPRASPASEQVLGAGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAIS
RVCEAVPGAKGAFRKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIA
NHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQAFELRFK
QYLQCPSKIPTLHDRFELEPFEDALKNQSVGPVLSKAASVECISPISPRAPDAKMLEELK
AEPWYQGEMSRKEAEGLLKRDGDFLVRKSTTNPGSFVLTGMHDGQAKHLLLVDPEGTIRT
KDRVFDSISHLINHHLENSLPIVSAGSELCLKQPVERSP
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgtttcaggaatgactcggtgacatcggtcgatgac
cttctgcacaacctgtcggtgagcagcggaggcaaggtctcggcgacgcgcgcggccccg
gcggcggccccctacctggtgtctggagacgcgttgcgcaaggcgcccgacgatggcccg
ggcagcctgggccacctgctccacaaggtgtcccacctaaaactctccagctcgggcctc
cgcggcctgtcggcggccagggagcgggcgggcgcgcggctctcgggcagctgcagcgcg
cccagcctggcagccccggacggcagctcgtcccccggcccccgcgccccggccatgcgc
gccgccaggaagggccggtccagcgacgagccgccgccccgcgcgtcccccgccagcgag
caggtgctgggggccggagtcacctacgtcgtcaagtacttggggtgcattgaagttcta
cgctcaatgaggtctcttgacttcagtacaagaacgcagattaccagggaggccatcagc
cgcgtttgtgaagctgtccctggagccaagggagccttcaggaagagaaagcctccgagc
aagatgctgtccagcatcttgggcaagagcaacctccagtttgcggggatgagcatctcc
ctgaccatatccactgccagcctgaacctgcggacgccggactcgaaacagattatagca
aatcaccacatgcagtccatctcctttgcctccggcggggacccggacacaacagactac
gttgcatacgtggccaaggaccctgttaatcgcagagcttgtcacattctggaatgctgt
gacgggctggcccaggacgtcattggctccatcggacaagcctttgagctccggtttaag
caatatctgcaatgtccttccaaaatccccactctccacgaccggtttgaactagaacct
tttgaagatgctctcaagaaccagtccgtgggacctgtgctgagcaaggcagcctctgtg
gagtgcatcagccccatctcacccagagccccggatgccaagatgctggaagagctgaaa
gcggagccttggtaccaaggcgagatgagcaggaaggaggcagaggggctactgaagcga
gacggagactttctggtcaggaagagcaccaccaacccgggctcctttgttctcacaggc
atgcatgatggccaggccaagcacctgctgctcgtggacccagaaggcacgatccggacg
aaggacagggtcttcgacagcatcagccatctcatcaaccaccatctggaaaacagcctg
cccattgtctccgcagggagtgagctctgcctgaagcagccagtggagaggagcccgtga

KEGG   Hipposideros armiger (great roundleaf bat): 109390676
Entry
109390676         CDS       T04661                                 

Gene name
SHC2
Definition
(RefSeq) SHC adaptor protein 2
  KO
K17447  SHC-transforming protein 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04062  Chemokine signaling pathway
hai04072  Phospholipase D signaling pathway
hai04370  VEGF signaling pathway
hai04510  Focal adhesion
hai04650  Natural killer cell mediated cytotoxicity
hai04722  Neurotrophin signaling pathway
hai04910  Insulin signaling pathway
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04926  Relaxin signaling pathway
hai04935  Growth hormone synthesis, secretion and action
hai05034  Alcoholism
hai05100  Bacterial invasion of epithelial cells
hai05214  Glioma
hai05220  Chronic myeloid leukemia
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109390676 (SHC2)
   04014 Ras signaling pathway
    109390676 (SHC2)
   04370 VEGF signaling pathway
    109390676 (SHC2)
   04072 Phospholipase D signaling pathway
    109390676 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109390676 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109390676 (SHC2)
   04062 Chemokine signaling pathway
    109390676 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109390676 (SHC2)
   04915 Estrogen signaling pathway
    109390676 (SHC2)
   04917 Prolactin signaling pathway
    109390676 (SHC2)
   04926 Relaxin signaling pathway
    109390676 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    109390676 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109390676 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109390676 (SHC2)
   05226 Gastric cancer
    109390676 (SHC2)
   05214 Glioma
    109390676 (SHC2)
   05220 Chronic myeloid leukemia
    109390676 (SHC2)
   05224 Breast cancer
    109390676 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    109390676 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    109390676 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109390676 (SHC2)
   01522 Endocrine resistance
    109390676 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 109390676
NCBI-ProteinID: XP_019513049
LinkDB
Position
Un
AA seq 625 aa
MTQGPGGRASPGPPAPPEPEAPTTFCALLPRMPQWKFAAPVGFLGRGQAAARAAGDAGVA
GGTDPQPESVGPASIPALAAAVLNACEPRCAAPCPLPALSRCRTAGPRGPRGARGTAGPP
DAGADEWIRKGSFIHKPAHGWLHPDARVLGSGVSYIVRYMGCIEVLCSMRSLDFNTRTQV
TREAINRLHEAVPGVRGSWKKKAPNKALASILGKSNLRFAGMSISISISTDGLNLSVPAT
RQIIANHHMQSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSVISTVGQAF
ELRFKQYLHSTPKVVVPPERLTGLEELAWGDEEDTEHNYYNSVPGKEPPLGGLVDSRLTL
TQPCALGTLGALSQGASPRRDARGLQWELGLSAPPGDGYVQADARGPRDYEDHLYVNTQG
LDAPEPLQPEDSPKKDLFDMRPPFPAGGSCRLPASCTPSSLAGPFEDALKLHECSVAVGT
AADPLLLEDQWPSPPTRRAPIAPTEEQLRQEPWYHGQMSRRTAEKLLRADGDFLVRDSVT
NPGQYVLTGMHAGQPKHLLLVDPEGVVMALALAPVPAPQTPLVWWPLVVAQPFLWTLVRP
EPPLSLLPPHGPRISLLQQALGWAG
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgacgcagggtcccggcgggcgcgcatcccccgggcctcctgcgcccccggagcccgag
gcgcccaccaccttctgcgcgctgctgccgcgcatgccgcagtggaagttcgcggccccg
gtcggcttcctgggtcgcggccaggcggcggcgcgggcggcgggggatgcgggggtcgcg
gggggcactgacccccagccggagtcggtcggcccggctagcatcccagcgctggcggct
gcggttctgaacgcctgcgagccgcgctgcgccgcgccctgccccctgccggcgctcagc
cgctgccggaccgccgggccgcggggtccgcggggcgcgcgggggactgccgggccccca
gacgccggcgccgacgagtggatccgcaaaggcagcttcatccacaagccggcgcatggc
tggctacacccagacgccagggtcctgggttctggggtctcctacatcgtgcggtacatg
ggctgtatcgaggtcctgtgctccatgcgctccctggacttcaatactcgcacccaggtc
accagggaagccatcaaccggctccatgaggctgtacctggcgtccggggctcctggaag
aagaaggctcccaacaaagcgctggcctccatcctgggcaagagcaacctgcgctttgcc
ggcatgagcatctccatcagcatctccactgacggcctaaacctctcagtgcccgctacg
cgccagatcatcgccaaccaccacatgcagtccatttccttcgcgtcgggcggtgacacg
gacatgacggattacgtggcctatgttgccaaggaccccatcaaccagagagcctgccac
atcctggagtgttgcgagggcctcgcccagagcgtcatcagcaccgtgggccaagccttt
gagctgcgcttcaaacagtatctgcacagcacccccaaggtggttgtccccccagaaagg
ctgaccgggctggaggagttggcctggggagacgaggaggacacagaacacaattactac
aacagtgtcccaggaaaggagccgcccctgggtgggcttgtggactccaggctcaccctg
acacagccctgtgccctcgggacccttggagccctcagccagggtgcatctcctcgaaga
gacgcccgtggcctgcagtgggagctgggcctctcagctccaccaggggatggctacgtg
caggcagacgcccgggggccccgagactacgaggaccacctgtatgtcaatacgcagggt
ctggatgccccggagcccctgcagcctgaggacagccccaagaaagacctgttcgacatg
cgccctcccttcccagcaggaggcagctgccggctccctgcctcctgcaccccgtcctca
ctcgcaggacccttcgaggatgccctgaagctgcatgagtgctccgtggcggtgggcaca
gcggcagatccccttctcttggaggaccagtggcccagcccccccacccgccgggcccct
atagcccccacggaggagcagctgcggcaggagccctggtaccacggccagatgagccgt
aggacggcggagaaactgctccgagcagacggggacttcctcgtgcgcgacagcgtcacc
aaccccgggcagtacgtcctcactggcatgcacgctgggcagcctaagcacctgctgctt
gtggatcctgagggcgtggtgatggctctagccctggctcctgtccctgctccccagaca
cccctggtgtggtggcctttagtggtggctcagccttttctctggaccctggtcaggccg
gaaccgccgctgtctctccttcctccacatgggcctcgaatctcccttctccagcaggcc
ttgggttgggctgggtaa

KEGG   Hipposideros armiger (great roundleaf bat): 109393422
Entry
109393422         CDS       T04661                                 

Gene name
SHC1
Definition
(RefSeq) SHC adaptor protein 1
  KO
K06279  SHC-transforming protein 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04062  Chemokine signaling pathway
hai04072  Phospholipase D signaling pathway
hai04510  Focal adhesion
hai04650  Natural killer cell mediated cytotoxicity
hai04722  Neurotrophin signaling pathway
hai04910  Insulin signaling pathway
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04926  Relaxin signaling pathway
hai04935  Growth hormone synthesis, secretion and action
hai05034  Alcoholism
hai05100  Bacterial invasion of epithelial cells
hai05206  MicroRNAs in cancer
hai05214  Glioma
hai05220  Chronic myeloid leukemia
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109393422 (SHC1)
   04014 Ras signaling pathway
    109393422 (SHC1)
   04072 Phospholipase D signaling pathway
    109393422 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109393422 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109393422 (SHC1)
   04062 Chemokine signaling pathway
    109393422 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109393422 (SHC1)
   04915 Estrogen signaling pathway
    109393422 (SHC1)
   04917 Prolactin signaling pathway
    109393422 (SHC1)
   04926 Relaxin signaling pathway
    109393422 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    109393422 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109393422 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109393422 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109393422 (SHC1)
   05226 Gastric cancer
    109393422 (SHC1)
   05214 Glioma
    109393422 (SHC1)
   05220 Chronic myeloid leukemia
    109393422 (SHC1)
   05224 Breast cancer
    109393422 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    109393422 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    109393422 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109393422 (SHC1)
   01522 Endocrine resistance
    109393422 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 109393422
NCBI-ProteinID: XP_019518138
LinkDB
Position
Un
AA seq 608 aa
MPLPGPLALTGRGAGLGSSLPLTPAMDRLPPKPKYNPLRNESLSSLEEGASGATPPEELP
SPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLKLASPAGGRSGPKGEPGRVAEDGEGIG
GAAVPDPGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKV
MGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRP
LSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVA
YVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVAPHDRMAGFDGS
AWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAPAGAARPTPPSAQTPSHLGATLP
VGQPVGGDPEVRKQMPPPSCPAGRELFDDPSYVNVQNLDKARQAGGGAGPPNPAVNGSAP
RDLFDMKPFEDALRVPPPPHSVAMAEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTT
TPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCL
QQPVERKL
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgcccctgcccggcccccttgcgctgaccggcaggggggccgggctgggcagcagcctc
cctctcacgccagccatggaccgcctgccccccaagcccaagtacaacccacttcggaat
gagtctctgtcatcgctggaggagggggcctcaggggccaccccaccggaggagctgcct
tccccatcagcctcgtccctggggcccatcctgccccctctgcccggggacgatagtccc
accaccctgtgctccttcttcccccggatgagcaacctgaagctggccagcccggctggg
gggcgctcggggccgaagggggagccaggcagggtggccgaggatggcgaggggatcgga
ggggcggccgtgccagacccaggtcccctgccccttctccaggacatgaacaagctgagt
ggaggcggcgggcgcaggactcgggtggaagggggccagctggggggcgaggagtggacc
cgccacgggagctttgtcaataagcccacgcggggctggctgcaccccaacgacaaagtc
atgggacccggggtttcctacttggttcggtacatgggctgtgtggaggtcctgcagtcg
atgcgcgccctagacttcaacacccgcacccaggtcaccagggaggccatcagtctggtg
tgtgaggctgtgccaggtgctaagggggcaacgagaaggagaaagccctgtagccgcccg
ctcagttccattctggggaggagtaacctgaaatttgctgggatgccaatcactctcacc
gtttccaccagcagcctcaacctcatggccgcagactgcaaacagatcatcgccaatcac
cacatgcagtctatctcgtttgcgtccggcggggacccggacacagccgagtacgttgcc
tacgtggccaaagacccggtgaatcagagagcctgccacatcctggagtgtcccgaaggg
ctcgctcaggacgtcatcagcaccatcggccaggccttcgagttgcgcttcaaacagtac
ctcaggaacccgcccaagctggtcgccccccatgacaggatggctggctttgatggctca
gcttgggatgaggaagaggaagaaccacctgaccatcagtactacaatgacttcccgggc
aaggaaccccctcttgggggggtggtagacatgaggcttcgggaaggcgcccccgcgggg
gctgctcgacccactccgcccagtgcccagacccccagccacctgggagctacgctgcct
gtggggcagcctgttgggggagacccagaagtccgcaagcagatgccacctccgtcctgc
ccagcaggcagagagctcttcgatgacccctcctatgtcaatgtccagaacttggacaag
gcccggcaagcagggggtggggctgggccccccaaccctgccgtcaatgggagtgcgccc
cgagacctctttgacatgaagcccttcgaagatgcccttcgggtgcctccccctccccat
tcggtggccatggccgagcagctccggggggagccctggttccacggcaagctgagccgc
cgggaggccgaggcgctgctgcagctcaacggggacttcctggtgcgggaaagcaccacc
acgcctggccagtacgtgctcacgggcctgcagagtgggcagcccaagcacctgctgctg
gtggaccctgagggcgtggttcggacaaaggatcaccgctttgagagcgtcagtcacctc
atcagctaccacatggacaatcacttgcccatcatctctgcaggcagcgaactgtgtcta
cagcaacccgtggagcggaaactgtga

KEGG   Hipposideros armiger (great roundleaf bat): 109394486
Entry
109394486         CDS       T04661                                 

Gene name
SHC4
Definition
(RefSeq) SHC adaptor protein 4
  KO
K17449  SHC-transforming protein 4
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04062  Chemokine signaling pathway
hai04072  Phospholipase D signaling pathway
hai04510  Focal adhesion
hai04650  Natural killer cell mediated cytotoxicity
hai04722  Neurotrophin signaling pathway
hai04910  Insulin signaling pathway
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04926  Relaxin signaling pathway
hai04935  Growth hormone synthesis, secretion and action
hai05034  Alcoholism
hai05100  Bacterial invasion of epithelial cells
hai05206  MicroRNAs in cancer
hai05214  Glioma
hai05220  Chronic myeloid leukemia
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109394486 (SHC4)
   04014 Ras signaling pathway
    109394486 (SHC4)
   04072 Phospholipase D signaling pathway
    109394486 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109394486 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109394486 (SHC4)
   04062 Chemokine signaling pathway
    109394486 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109394486 (SHC4)
   04915 Estrogen signaling pathway
    109394486 (SHC4)
   04917 Prolactin signaling pathway
    109394486 (SHC4)
   04926 Relaxin signaling pathway
    109394486 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    109394486 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109394486 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109394486 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109394486 (SHC4)
   05226 Gastric cancer
    109394486 (SHC4)
   05214 Glioma
    109394486 (SHC4)
   05220 Chronic myeloid leukemia
    109394486 (SHC4)
   05224 Breast cancer
    109394486 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    109394486 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    109394486 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109394486 (SHC4)
   01522 Endocrine resistance
    109394486 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 109394486
NCBI-ProteinID: XP_019520128
LinkDB
Position
Un
AA seq 629 aa
MRERSQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSPGGSVGNKSSQQPPY
PVLAPHLPAEDATLASQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPGPSNPASPETSLNRAGLAPQPQQDVVRHRATTLAPDACPLPGPGEPTPGSRQDRQ
FLQHLLGIGMSYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSSVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEVH
TDGAAEERGDHEYYNEIPGKQPPLGGVSDVRIKVQATEQMAYCPIRCEKLCYLPGNSKCS
SVYENCLEQSRAIGNAQERGVQAQRDTSLMKHTCRVDLFDDPCYINTQALQSTLGSARNQ
SSAHSLGSPWHCEKAPETVQPGAMTQPASSHSLPHIRQQLRSEDCYHGKLSRKAAESLLV
KDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNS
LPIISSGSEVSLKQPVRKDNNPGLLHSSK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgcgagaacgcagtcaggacagcttggcaggactcgtgctgtatgtaggactcttcggg
caccccggaatgctgcacagggccaagtacagccgctttcggaatgagtccatcacatcc
ttggacgaaggcagccccggaggctccgtcgggaacaagagctcgcagcagcctccgtac
cccgtcctggctcctcacttgccggctgaagatgccaccttggcgtcccaggagagcccc
accccactgtgcaccttgatcccgcgcatggccagcatgaagctagccaacccagccacc
ttgctgagtctgaaaaacttttgcttgggtaccaaagaggtgccccggctgaagctccag
gaaagccaggacccaggtcccagcaacccggcttcccctgaaaccagcctaaacagggcc
gggttggcacctcagccgcagcaggacgtggtgaggcaccgggccaccaccttagctcct
gatgcctgccctctccccggccctggggagccaactccggggagcaggcaggacaggcag
tttctgcagcacctgttggggataggcatgagctactatgtgaggtacatgggctgtatt
gaagtgctacaatcaatgaggtccctggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccctggggcaaacggagccattaaaaagcgtaag
cctccagttaagttcctatcatccgttcttggcaaaagtaatcttcagttttcgggaatg
aatataaaactgaccatctcaacatgcagcctcacactgatgaatcttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaaagagcctgccacatattg
gaatgccgcaatggaatggcccaagacgtcataagtaccattgggcaggcttttgagctc
cggtttaaacagtatttgaaaaatccttctttgaatacttcttgtgaaagtgaggtgcac
actgatggcgctgccgaggagagaggagatcacgagtattacaacgaaataccggggaag
cagccacccttaggtggtgtttcagatgtgcggatcaaagttcaagccacagaacaaatg
gcttactgccccatacggtgtgaaaagttgtgctatttgcctggaaactccaagtgcagc
agtgtatacgagaactgtttggaacaaagcagagcaataggtaatgcccaagagagaggg
gtgcaggcccagagagacacctcattaatgaagcatacatgtcgagtggatctcttcgac
gacccctgctacattaatacgcaggctcttcagagtacacttggctctgcccgaaatcaa
agctcagctcactcactgggaagcccgtggcactgtgaaaaagcaccagaaactgttcag
ccaggtgccatgacccagcctgccagctcacattctttgccacacattaggcagcagctg
cggagtgaagactgctaccacggcaagctgagcaggaaggcggcagagagcctcttagtc
aaggacggggactttttggttcgagagagtgcaacatctcctggccagtatgtactgagt
ggactacagggaggccaggcaaaacaccttctcctggtagatccggaaggcaaggtgagg
accaaggatcatgtatttgataatgtcggccaccttatcagataccacatggataatagt
ttgccaatcatctcttctggaagtgaagtaagccttaaacaaccagtgagaaaagataat
aatccaggacttttgcattcaagcaaatga

DBGET integrated database retrieval system