KEGG   Hipposideros armiger (great roundleaf bat): 109377126
Entry
109377126         CDS       T04661                                 

Gene name
FAS
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01524  Platinum drug resistance
hai04010  MAPK signaling pathway
hai04060  Cytokine-cytokine receptor interaction
hai04115  p53 signaling pathway
hai04210  Apoptosis
hai04217  Necroptosis
hai04650  Natural killer cell mediated cytotoxicity
hai04668  TNF signaling pathway
hai04932  Non-alcoholic fatty liver disease
hai04940  Type I diabetes mellitus
hai05010  Alzheimer disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05142  Chagas disease
hai05143  African trypanosomiasis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05320  Autoimmune thyroid disease
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109377126 (FAS)
   04668 TNF signaling pathway
    109377126 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109377126 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109377126 (FAS)
   04217 Necroptosis
    109377126 (FAS)
   04115 p53 signaling pathway
    109377126 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109377126 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109377126 (FAS)
   05205 Proteoglycans in cancer
    109377126 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109377126 (FAS)
   05330 Allograft rejection
    109377126 (FAS)
   05332 Graft-versus-host disease
    109377126 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109377126 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    109377126 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109377126 (FAS)
   04932 Non-alcoholic fatty liver disease
    109377126 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109377126 (FAS)
   05162 Measles
    109377126 (FAS)
   05164 Influenza A
    109377126 (FAS)
   05161 Hepatitis B
    109377126 (FAS)
   05160 Hepatitis C
    109377126 (FAS)
   05168 Herpes simplex virus 1 infection
    109377126 (FAS)
   05163 Human cytomegalovirus infection
    109377126 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109377126 (FAS)
   05169 Epstein-Barr virus infection
    109377126 (FAS)
   05165 Human papillomavirus infection
    109377126 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109377126 (FAS)
   05143 African trypanosomiasis
    109377126 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109377126 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hai04050]
    109377126 (FAS)
   04090 CD molecules [BR:hai04090]
    109377126 (FAS)
Cytokine receptors [BR:hai04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109377126 (FAS)
CD molecules [BR:hai04090]
 Proteins
  109377126 (FAS)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 109377126
NCBI-ProteinID: XP_019488924
LinkDB
Position
Un
AA seq 161 aa
TRKETDCTINGGDPGCLPCPEGREYTDSKHYSSKCRRCGSCDGEHGLEVEINCTRTRNTK
CRCKSNFFCNTPPCEHCNPCKSCEHGIMENCTTTTNTKCKEGSSHELRWLWILALIPPAV
VLTVWLVKRKCENNGHHTFTPSNTEMVPMNLPGKAFIILLQ
NT seq 488 nt   +upstreamnt  +downstreamnt
gcacacggaaagagactgactgcacaattaatgggggtgatccaggctgtctaccctgcc
cagaagggcgagagtacacagacagcaaacattattcttctaaatgcagaagatgtggaa
gttgtgatggagaacatggcttagaagtggaaataaactgtacccggacccggaatacca
agtgcagatgtaaatcaaactttttttgtaacacccctccatgcgaacactgtaaccctt
gcaagagttgtgaacatggaatcatggagaactgcacaaccaccaccaacaccaaatgta
aagaaggatccagtcatgaattacggtggttgtggatcctggccctgattccaccagcag
ttgtactaacagtttggctggtgaaaagaaagtgcgagaataatggtcaccatacattta
caccttcaaataccgaaatggtcccaatgaatttaccaggtaaggcttttatcattttac
ttcaatag

DBGET integrated database retrieval system