KEGG   Hipposideros armiger (great roundleaf bat): 109377242
Entry
109377242         CDS       T04661                                 

Gene name
E2F1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai04110  Cell cycle
hai04137  Mitophagy - animal
hai04218  Cellular senescence
hai04934  Cushing syndrome
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05206  MicroRNAs in cancer
hai05212  Pancreatic cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109377242 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    109377242 (E2F1)
   04218 Cellular senescence
    109377242 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109377242 (E2F1)
   05206 MicroRNAs in cancer
    109377242 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109377242 (E2F1)
   05225 Hepatocellular carcinoma
    109377242 (E2F1)
   05226 Gastric cancer
    109377242 (E2F1)
   05214 Glioma
    109377242 (E2F1)
   05220 Chronic myeloid leukemia
    109377242 (E2F1)
   05218 Melanoma
    109377242 (E2F1)
   05219 Bladder cancer
    109377242 (E2F1)
   05215 Prostate cancer
    109377242 (E2F1)
   05224 Breast cancer
    109377242 (E2F1)
   05222 Small cell lung cancer
    109377242 (E2F1)
   05223 Non-small cell lung cancer
    109377242 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109377242 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109377242 (E2F1)
   05161 Hepatitis B
    109377242 (E2F1)
   05160 Hepatitis C
    109377242 (E2F1)
   05163 Human cytomegalovirus infection
    109377242 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109377242 (E2F1)
   05169 Epstein-Barr virus infection
    109377242 (E2F1)
   05165 Human papillomavirus infection
    109377242 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109377242 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109377242 (E2F1)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    109377242 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 109377242
NCBI-ProteinID: XP_019489066
LinkDB
Position
Un
AA seq 436 aa
MAVAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISTAQDASAPPAPAGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGMK
SPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHAAVGIGGRLEGLTQDLQQLQENERQLDHLIHICTTQLRLLSEDTDN
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAMDSSETFQISLKSKQGPIDVFLCPE
ESEGGISPRKTPSQGAPSGEEDRAADPATTVPPPSSPTSSPATDPSQSLLSLEQEPLLSR
MGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGI
RDLFDCDFGDLTPLDF
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggccgtggccggggcccccgcgggcggcccatgcgcgccggcgctggaggccctgctc
ggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctccacggcgcag
gacgccagcgccccaccggcccccgctggccctgcagcgcccgctgcgggtccctgcgac
cccgacctgctactcttcgccacgccgcaggcgccccggcccacacccagcgcgccgcgt
cctgcgctcggccgcccgccggtgaagcggaggctggacctggaaactgaccatcaatac
ctggctgagagtagtgggccagcccggggcagaggccgtcacccaggaaaaggtatgaaa
tccccaggggagaagtcccgctatgaaacatcactgaatctgaccaccaaacgcttcctg
gagctgctgagtcgctcggctgatggtgttgttgacctgaactgggcagccgaggtgctg
aaggtgcaaaaacggcgcatctacgacatcaccaatgtcctcgagggcatccagctcatt
gccaagaagtctaagaaccacatccagtggctaggcagccatgcagctgtggggattggt
gggcggcttgaaggactgacccaggacctccagcagctgcaggagaatgagcggcagctg
gaccacctgatccacatctgtaccacgcagctgcggctgctctctgaggacaccgacaac
cagcgcctggcctacgtgacctgccaggaccttcgtagtatcgcagaccctgcagagcag
atggtcatggtgatcaaggcccctcccgagacccagcttcaagccatggactcctcagag
acctttcagatctcccttaagagcaaacaaggccccatcgatgttttcctgtgccctgag
gagagtgagggcgggatcagccccaggaagaccccatcccagggggcaccttctggggag
gaggacagggcagctgaccctgccaccacagtgccaccaccatcatctcccacctcatcc
cctgccacggatcccagccagtccctgctcagcctggagcaagaacctctgctttcccgg
atgggcagcttgcgggcccctgtggacgaggaccgcctgtccccgctggtggctgccgac
tctctcctggagcatgtgcgggaggacttctctggccttctgcctgaggagttcataagc
ctgtctcccccccacgaggccctcgactaccactttggccttgaggagggcgagggcatc
agagacctttttgactgtgactttggggacctcacccccctggatttctga

KEGG   Hipposideros armiger (great roundleaf bat): 109381623
Entry
109381623         CDS       T04661                                 

Gene name
E2F3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai04110  Cell cycle
hai04218  Cellular senescence
hai04934  Cushing syndrome
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05206  MicroRNAs in cancer
hai05212  Pancreatic cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109381623 (E2F3)
   04218 Cellular senescence
    109381623 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381623 (E2F3)
   05206 MicroRNAs in cancer
    109381623 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109381623 (E2F3)
   05225 Hepatocellular carcinoma
    109381623 (E2F3)
   05226 Gastric cancer
    109381623 (E2F3)
   05214 Glioma
    109381623 (E2F3)
   05220 Chronic myeloid leukemia
    109381623 (E2F3)
   05218 Melanoma
    109381623 (E2F3)
   05219 Bladder cancer
    109381623 (E2F3)
   05215 Prostate cancer
    109381623 (E2F3)
   05224 Breast cancer
    109381623 (E2F3)
   05222 Small cell lung cancer
    109381623 (E2F3)
   05223 Non-small cell lung cancer
    109381623 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109381623 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109381623 (E2F3)
   05161 Hepatitis B
    109381623 (E2F3)
   05160 Hepatitis C
    109381623 (E2F3)
   05163 Human cytomegalovirus infection
    109381623 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109381623 (E2F3)
   05169 Epstein-Barr virus infection
    109381623 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109381623 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109381623 (E2F3)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    109381623 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 109381623
NCBI-ProteinID: XP_019496021
LinkDB
Position
Un
AA seq 347 aa
MTLVRFLTQGTNEAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTR
YDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNN
VQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAY
VTYQDIRKISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETH
SPMKTNNQDHNGNIPKPTSKDLASSNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNL
EGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgactctcgtgaggtttcttacccaggggacaaatgaggccaagcgaaggctggagcta
ggagaaagcggtcatcagtacctctcagatggtttaaaaacccctaagggcaaagggaga
gctgcactgcgaagtccagacagtcccaaaactccaaaatctccctcagaaaaaacacgg
tatgatacatcacttggtctgctcaccaagaagttcattcagctactgagccagtcgcct
gatggggtcttggatttgaacaaggcagcagaggtgctgaaagtgcaaaagagaaggatt
tatgatatcaccaatgtactggaaggcatccacctcattaagaagaagtcaaaaaacaac
gtgcaatggatgggctgcagtctgtctgaggacgggggcatgctggcccagtgtcaaggc
ctgtcaaaggaagtgaccgagctcagtcaggaggagaagaaattagatgaactgatccaa
agctgcaccctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttat
gttacatatcaagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtg
aaagcccctccagaaacaagacttgaagtgcctgacccaatagagagcctacaaatacac
ttggcaagtacccaaggacccattgaggtttacttgtgtccagaagagacggaaacacac
agcccaatgaaaacaaacaaccaagaccacaatggaaatatccccaaacccacttccaaa
gacttggcttcaagcaactcaggacatagtgactgctcgatttctatggcaaacctttct
cctttggcctccccagccaaccttttacagcagactgaggaccaaattccttccaaccta
gaaggaccatttgtgaacttactgcctcccctgctccaagaagactatctcctaagcctc
ggggaggaagaaggcatcagcgatctctttgatgcttacgatttggaaaagctcccgctg
gtggaagactttatgtgtagttga

KEGG   Hipposideros armiger (great roundleaf bat): 109386699
Entry
109386699         CDS       T04661                                 

Gene name
E2F2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai04110  Cell cycle
hai04218  Cellular senescence
hai04934  Cushing syndrome
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05206  MicroRNAs in cancer
hai05212  Pancreatic cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109386699 (E2F2)
   04218 Cellular senescence
    109386699 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109386699 (E2F2)
   05206 MicroRNAs in cancer
    109386699 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109386699 (E2F2)
   05225 Hepatocellular carcinoma
    109386699 (E2F2)
   05226 Gastric cancer
    109386699 (E2F2)
   05214 Glioma
    109386699 (E2F2)
   05220 Chronic myeloid leukemia
    109386699 (E2F2)
   05218 Melanoma
    109386699 (E2F2)
   05219 Bladder cancer
    109386699 (E2F2)
   05215 Prostate cancer
    109386699 (E2F2)
   05224 Breast cancer
    109386699 (E2F2)
   05222 Small cell lung cancer
    109386699 (E2F2)
   05223 Non-small cell lung cancer
    109386699 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109386699 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109386699 (E2F2)
   05161 Hepatitis B
    109386699 (E2F2)
   05160 Hepatitis C
    109386699 (E2F2)
   05163 Human cytomegalovirus infection
    109386699 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109386699 (E2F2)
   05169 Epstein-Barr virus infection
    109386699 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109386699 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109386699 (E2F2)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    109386699 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 109386699
NCBI-ProteinID: XP_019505651
LinkDB
Position
Un
AA seq 436 aa
MLRGPRALAPAAGPPFKGLPVISPTELWPPCLGSPQLYPVTTTYYTPLYPQIVPPTAAPG
TCLDATPHRPESQAVRCVPAGRLPAKRKLDLEGIGKPAVLEFQTPKGKCIKVDGLPSPQT
PKSPGEKSRYDTSLGLLTKKFICLLKESKDEVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LISKKAKNNIQWVSKGMFEDPTRPGRQEQLGQELKELMSKEQALDQLIQSCSLDFKHLTE
DKTNKRLAYVTYEDLRAVSNFQEQTVIAVRAPPHTRLEVPDMSEQNLQLHLKSTQGPIEV
YLCPEEVQEPDSPTKEPLPSTSTLSPSPDSTRPSCSTNPGILEPMASPAPALTSQQVLSP
APSLVPLEATDSMLELSYPLLQQTEDQFLSPTLPGSSPLISFSPPLDQDDYLWGLDGGEG
ISDLFDSYDFGDLLIE
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgctgcgagggccccgggccctggctccggccgctggaccacccttcaaggggttaccc
gtgataagccccaccgagctgtggccgccctgcctcggcagcccccagctctatccggtc
accactacctactacaccccgctgtacccgcagattgtgcctcccactgcggcgcccggc
acctgcctcgacgccaccccccaccgaccagagagccaagctgtgcgatgcgtgccggct
ggccggctgccggcgaaaaggaagctggacctcgagggaattgggaagcctgcagtcctg
gaatttcagactcccaaggggaagtgcattaaagtggatggcctccccagcccccaaact
cccaagtcccctggggagaagtctcggtatgacacgtcgctggggctgctcaccaagaag
ttcatctgccttctgaaagagtccaaggatgaggtcttggacctgaactgggctgctgag
gtgctggatgtgcagaagcggcgcatctatgacatcaccaatgtgctggagggcatccag
ctcatcagcaagaaggccaagaacaacatccagtgggtaagtaagggaatgtttgaagat
cccacccggcctgggaggcaggagcagctgggacaggagctgaaagaactgatgagcaag
gagcaggccttggaccagctcatccagagttgctctctggacttcaagcacctgaccgag
gacaagaccaacaagagactggcctatgtgacttacgaggacctacgtgctgtcagtaac
tttcaagagcagacagtgatcgctgtcagggccccgccacatacgagactggaagtgccc
gacatgagcgagcagaacctgcagttacacctgaagagtacgcaagggcccatcgaagtc
tacctgtgcccggaggaggtgcaggaaccggacagtcctaccaaggaacccctcccctcc
acttccactctcagccccagccctgactccacccggcccagctgcagcaccaaccctggg
atcctggaacccatggcatccccagcgccagcgctgacttcccagcaggtcctgtcacca
gcgccatcccttgttcctctggaggccactgacagcatgctggagctgtcatacccactt
ctgcagcagactgaagaccagttcttgtctccaaccctgccgggcagctcccctctgatc
agcttctctccgcccttggaccaggatgactacctgtggggcctagatgggggtgagggc
attagtgacctctttgactcctatgactttggggacctgctgattgagtga

DBGET integrated database retrieval system