KEGG   Hipposideros armiger (great roundleaf bat): 109377341
Entry
109377341         CDS       T04661                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04015  Rap1 signaling pathway
hai04310  Wnt signaling pathway
hai04390  Hippo signaling pathway
hai04510  Focal adhesion
hai04520  Adherens junction
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04670  Leukocyte transendothelial migration
hai04916  Melanogenesis
hai04919  Thyroid hormone signaling pathway
hai04934  Cushing syndrome
hai05010  Alzheimer disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05100  Bacterial invasion of epithelial cells
hai05132  Salmonella infection
hai05160  Hepatitis C
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05210  Colorectal cancer
hai05213  Endometrial cancer
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05412  Arrhythmogenic right ventricular cardiomyopathy
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109377341 (CTNNB1)
   04310 Wnt signaling pathway
    109377341 (CTNNB1)
   04390 Hippo signaling pathway
    109377341 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109377341 (CTNNB1)
   04520 Adherens junction
    109377341 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    109377341 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109377341 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109377341 (CTNNB1)
   04916 Melanogenesis
    109377341 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109377341 (CTNNB1)
   05205 Proteoglycans in cancer
    109377341 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109377341 (CTNNB1)
   05225 Hepatocellular carcinoma
    109377341 (CTNNB1)
   05226 Gastric cancer
    109377341 (CTNNB1)
   05216 Thyroid cancer
    109377341 (CTNNB1)
   05217 Basal cell carcinoma
    109377341 (CTNNB1)
   05215 Prostate cancer
    109377341 (CTNNB1)
   05213 Endometrial cancer
    109377341 (CTNNB1)
   05224 Breast cancer
    109377341 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109377341 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    109377341 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109377341 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109377341 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109377341 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109377341 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    109377341 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109377341 (CTNNB1)
   05163 Human cytomegalovirus infection
    109377341 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109377341 (CTNNB1)
   05165 Human papillomavirus infection
    109377341 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 109377341
NCBI-ProteinID: XP_019489217
LinkDB
Position
Un
AA seq 782 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDNT
QQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHP
TNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLS
KKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPA
LVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTD
CLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVE
AGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTC
AAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAE
MAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQL
LVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLF
VQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVL
FRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSF
HSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDT
DL
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggcaacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcagcagtcttacctggactctggaatccattctggtgccacc
accacagcgccttctctgagtggtaaaggcaaccctgaggaagaggacgtggataacacc
cagcaagtcctgtacgagtgggaacaggggttttcacagtccttcactcaagaacaagta
gctgatattgatggacagtatgcaatgactcgagctcagagggtgcgcgctgctatgttc
ccagagactttagatgagggcatgcagatcccatccacacagtttgatgccgctcatccc
actaacgtccaacgtctggctgaaccatcacagatgctaaaacatgcagttgtcaatttg
attaactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactg
ctaaatgacgaggaccaggtggtggttaataaggcagcagttatggtccatcagctttct
aaaaaggaagcttccagacacgccatcatgcgttcccctcagatggtgtctgctattgta
cgtaccatgcagaatacaaatgatgtggaaacagctcgctgtactgctgggaccttgcac
aatctgtcccatcatcgtgagggcttgctggccatctttaagtctgggggcattcctgcc
ctggtgaagatgcttggttcaccggtggattctgtattgttttatgccatcacaactctc
cacaaccttttattgcatcaagaaggagccaaaatggcagtgcgtttggctggcgggctg
cagaaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaacagac
tgccttcagattttagcttatggcaatcaagaaagcaagctgatcattctggctagtggt
ggacctcaagctttagttaatataatgaggacctacacttacgagaaactactgtggacc
acaagcagagtactgaaggtgctgtctgtctgctctagcaataagccggctatcgtagag
gctggtggaatgcaagcgttaggacttcacctgacagatccaagtcaacgtcttgttcag
aactgtctttggactcttaggaatctttcagatgctgcaactaaacaggaagggatggaa
ggtctgcttgggacccttgttcagctgttgggctcagatgatattaatgtggtcacctgt
gcagctggaattctttctaatctcacttgcaataattataagaacaagatgatggtgtgc
caagttggcggtatagaggctcttgtgcgtactgtccttcgtgctggtgatagggaggac
atcaccgagcctgccatctgtgcccttcgtcatctgaccagtcgacaccaggaagcagag
atggcccagaatgctgttcgcctccactatggacttccggttgtggttaaactcctacac
ccaccatcccattggcctctgataaaggctaccgttggattgattcgaaatcttgccctt
tgcccggcaaatcatgcacctttgcgtgagcagggtgccatcccgcggctagttcagctg
ctggttcgtgcacatcaggatacccagcgccgtacgtctatgggcggaacccagcagcag
tttgtggagggggtccgcatggaagaaatagtcgaaggttgtactggagcccttcacatc
ctcgctcgggatgttcacaaccgaatcgttatcagaggactaaacaccattccattgttt
gtgcagctgctttactctcccattgaaaacatccaaagagtagctgcaggggtcctctgt
gaacttgctcaggacaaggaggctgcagaagccattgaagccgagggggccacagctcct
ctgacagagttactgcactcaaggaatgaaggtgtggcaacatacgcagctgctgttctg
ttccgaatgtccgaggacaagccgcaggattataagaagcggctttccgttgagctgacc
agttctctcttcagaacggagcccatggcttggaatgagactgctgaccttggacttgat
attggtgcccagggagaaccccttggatatcgccaggatgatcccagctatcgttctttt
cactctggtggatatggccaggatgccttgggaatggaccccatgatggagcatgagatg
ggtggccatcaccctggtgctgactatccagttgatgggctgccagatctggggcatgcc
caggacctcatggacgggctgcctccaggtgacagcaatcagctggcctggtttgatact
gacctgtaa

DBGET integrated database retrieval system