KEGG   Hipposideros armiger (great roundleaf bat): 109377344
Entry
109377344         CDS       T04661                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01523  Antifolate resistance
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04062  Chemokine signaling pathway
hai04064  NF-kappa B signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04380  Osteoclast differentiation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04625  C-type lectin receptor signaling pathway
hai04657  IL-17 signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04668  TNF signaling pathway
hai04920  Adipocytokine signaling pathway
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05212  Pancreatic cancer
hai05215  Prostate cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05340  Primary immunodeficiency
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109377344 (IKBKG)
   04014 Ras signaling pathway
    109377344 (IKBKG)
   04064 NF-kappa B signaling pathway
    109377344 (IKBKG)
   04668 TNF signaling pathway
    109377344 (IKBKG)
   04151 PI3K-Akt signaling pathway
    109377344 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109377344 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109377344 (IKBKG)
   04621 NOD-like receptor signaling pathway
    109377344 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    109377344 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    109377344 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    109377344 (IKBKG)
   04660 T cell receptor signaling pathway
    109377344 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    109377344 (IKBKG)
   04659 Th17 cell differentiation
    109377344 (IKBKG)
   04657 IL-17 signaling pathway
    109377344 (IKBKG)
   04662 B cell receptor signaling pathway
    109377344 (IKBKG)
   04062 Chemokine signaling pathway
    109377344 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109377344 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109377344 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109377344 (IKBKG)
   05203 Viral carcinogenesis
    109377344 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109377344 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109377344 (IKBKG)
   05221 Acute myeloid leukemia
    109377344 (IKBKG)
   05220 Chronic myeloid leukemia
    109377344 (IKBKG)
   05215 Prostate cancer
    109377344 (IKBKG)
   05222 Small cell lung cancer
    109377344 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    109377344 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109377344 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109377344 (IKBKG)
   05135 Yersinia infection
    109377344 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109377344 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    109377344 (IKBKG)
   05162 Measles
    109377344 (IKBKG)
   05164 Influenza A
    109377344 (IKBKG)
   05161 Hepatitis B
    109377344 (IKBKG)
   05160 Hepatitis C
    109377344 (IKBKG)
   05168 Herpes simplex virus 1 infection
    109377344 (IKBKG)
   05163 Human cytomegalovirus infection
    109377344 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109377344 (IKBKG)
   05169 Epstein-Barr virus infection
    109377344 (IKBKG)
   05165 Human papillomavirus infection
    109377344 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109377344 (IKBKG)
   05142 Chagas disease
    109377344 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109377344 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109377344 (IKBKG)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109377344 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 SO_alpha_A3 LLC1
Other DBs
NCBI-GeneID: 109377344
NCBI-ProteinID: XP_019489218
LinkDB
Position
Un
AA seq 420 aa
MSGPPWKSQPCEMVQPSGGPAGDQDVLGEEPSLGKAAMLHLPSEQGAPETFQRCLEENQE
LRDAIRQSNQMLRECCEELQRFQGSQREEKEFLMQRFQEARRLVERLSLEKLDLRRQREQ
ALQEVEHLKRCQQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASE
QARQLESEREALQQQHNVQVDQLRMQTQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQ
EYDNHIKSSMVSSERNRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVP
VLKAQADIYKTDFQAEREAREKLAEKKELLQEQLEQLQRDYSRLKASCQESARIEDMRKR
HVEVSQPPLAPASAHHSFHLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgagcgggcccccctggaagagtcagccgtgtgagatggtgcagcccagcggtggcccg
gccggggaccaggacgtgctgggcgaagagccttctctggggaaggcggccatgctccac
ctgccttcggagcagggtgctcctgagaccttccagcgctgtctagaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagtgctgtgaggagctgcag
cgtttccaaggcagccagagggaggagaaggaattcctcatgcagaggttccaggaggcc
aggagactggtagagagactgagtctggagaagctcgacctgaggaggcagagggagcag
gccctgcaggaggtggagcacctgaagagatgccagcagcagcagatggccgaggacaag
gcctcagtgaaagcccaggtgacgtccttgctaggggagctccaggaaagccagagtcgc
ttggaggctgccaccaaggagcggcaggctttggagggcagggcccgggcagccagtgag
caggcccggcagctggagagcgagcgggaggcgctgcagcaacagcacaacgtgcaggtg
gaccagctgcgcatgcagacccagagcatggaggctgccctgcgcatggaacgccaggct
gcctcggaggagaagcggaagctggcccagctacaggtggcctatcaccagctcttccaa
gagtatgacaatcacatcaagagcagtatggtgagcagtgagcgaaaccgaggaatgcag
ttggaagatctcaagcagcaacttcagcaggccgaggaggccctggtggccaaacaggaa
gtgattgacaagctgaaggaagaggctgagcagcacaagattgtgatggagaccgttccg
gtgctgaaggcccaggcggatatctacaagacggacttccaggctgagagggaggcccgg
gagaagttggccgagaagaaggagctcctgcaggaacagctggagcagctgcagcgggac
tatagcaggctgaaggccagctgtcaggagtcagccaggattgaagacatgaggaagcgg
cacgtagaggtctcccaaccccccttggcccctgcctcagctcaccactcttttcacctg
gccctgcctagccagaggagaagcccccccgaggagccgcctgacttctgttgccccaag
tgccagtaccaggctcctgatatggacaccctgcagattcacgttatggagtgcatcgag
tag

DBGET integrated database retrieval system