KEGG   Hipposideros armiger (great roundleaf bat): 109377392
Entry
109377392         CDS       T04661                                 

Gene name
XPO1
Definition
(RefSeq) exportin 1
  KO
K14290  exportin-1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03008  Ribosome biogenesis in eukaryotes
hai03013  RNA transport
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109377392 (XPO1)
   03008 Ribosome biogenesis in eukaryotes
    109377392 (XPO1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109377392 (XPO1)
   05164 Influenza A
    109377392 (XPO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109377392 (XPO1)
   03009 Ribosome biogenesis [BR:hai03009]
    109377392 (XPO1)
   03016 Transfer RNA biogenesis [BR:hai03016]
    109377392 (XPO1)
   03036 Chromosome and associated proteins [BR:hai03036]
    109377392 (XPO1)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     109377392 (XPO1)
Ribosome biogenesis [BR:hai03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    109377392 (XPO1)
  Pre-60S particles
    109377392 (XPO1)
Transfer RNA biogenesis [BR:hai03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    109377392 (XPO1)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     109377392 (XPO1)
SSDB
Motif
Pfam: CRM1_C Xpo1 CRM1_repeat_2 CRM1_repeat_3 CRM1_repeat IBN_N Hydrolase_3
Other DBs
NCBI-GeneID: 109377392
NCBI-ProteinID: XP_019489300
LinkDB
Position
Un
AA seq 1071 aa
MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAW
TRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCV
EKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFD
FSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGY
IFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPL
NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLIEKRLNLRETLMEALHYMLLVSEV
EETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPVLSKVRLLM
VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKL
HNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAII
ASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV
QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLL
PNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV
YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPL
LDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE
YPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTL
LQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKIST
PLNPGNPVNNQMFIQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLV
QIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD
NT seq 3216 nt   +upstreamnt  +downstreamnt
atgccagcaattatgacaatgttagcagaccatgcagctcgtcagctgcttgatttcagc
caaaaactggatatcaaccttttagacaatgtcgtgaattgcttataccatggagaagga
gcccagcaaagaatggctcaagaagtactgacacatttaaaggagcatcctgatgcgtgg
acaagagtcgacacaattttggaattttcacagaatatgaacacgaaatattatggacta
caaattttggaaaacgtgataaaaacaaggtggaagattcttccaaggaaccagtgtgaa
ggaataaaaaagtatgtcgttggcctcattatcaagacatcatcggacccaacttgtgta
gagaaggagaaggtgtatattgggaaattgaatatgattcttgttcagatactgaaacaa
gaatggccaaaacactggccgacttttatcagtgacattgttggagcaagtaggaccagt
gaaagtctctgtcagaataatatggtgattctcaaactcttgagtgaagaagtatttgat
ttctctagtggacagataacccaagtgaaagctaagcatttaaaagacagcatgtgcaat
gaattctcacaaatctttcagctgtgtcagtttgtgatggaaaattcccaaaatgctcca
cttgtacatgcaactttggaaacattgctcagatttcttaactggattccactgggatat
atttttgagaccaagttaatcagcacattaatttataagtttctgaatgttccaatgttt
cgaaatgtctctctgaagtgcctcactgagattgctggtgtgagtgtaagccaatatgag
gaacagtttgtaacgctatttacactgacaatgatgcagctaaaacagatgcttccttta
aataccaatattcgacttgcatactcaaatggaaaagatgatgaacagaactttattcaa
aatctcagtttgtttctctgcacatttcttaaggaacatgggcaacttatagaaaaaaga
ctaaatctcagggaaacactcatggaggcccttcattatatgttgttggtatcagaagtg
gaggaaacggaaatctttaagatttgtctcgaatactggaatcatttggcagcagaactt
tatagagagagcccattctctacatctgcttctccgttactatccggaagtcaacatttt
gatgttcctcctcggagacagttgtatttgcctgtgttatccaaggtccgtttattgatg
gttagtcgtatggctaaaccagaggaagtattggttgtagaaaatgatcagggagaagtt
gtaagagaattcatgaaggatacagattccataaatttgtataagaatatgagagaaaca
ttagtttatcttactcatctggattatgtagatacagaaagaataatgactgaaaagctt
cacaatcaagtgaatggtacagagtggtcatggaaaaatttaaatacattgtgttgggca
ataggctccattagtggagcaatgcatgaagaggatgaaaaacgatttcttgttactgtt
ataaaggatctgttaggattatgtgaacagaaaagaggcaaagataataaagctatcatt
gcatcaaatatcatgtacatagtaggtcaatatccaagatttttaagagctcactggaaa
tttttgaagactgtagttaacaagctgtttgaattcatgcatgagacccacgatggagtc
caggacatggcttgtgatactttcattaaaatagctcaaaaatgccgcaggcattttgtt
caggttcaggttggagaagtaatgccatttattgatgagattttgaacaacattaacact
ataatttgtgaccttcagcctcaacaggtccatacattttatgaagctgtggggtacatg
attggtgcacagacagaccaaacagtacaagaacatttgatagaaaaatatatgctactc
cctaatcaagtttgggatagcataatccagcaagcaaccaaaaatgtggatatacttaaa
gatccagaaacagtcaagcagttaggtagcatattgaaaacaaatgtgagagcctgcaaa
gctgttggacacccctttgtaattcaacttgggagaatttatttagatatgcttaatgta
tacaagtgcctcagtgaaaatatttctgcagctatccaagctaatggtgagatggttaca
aaacagccattgattagaagtatgcgaacagtaaaaagggaaactttgaagttaatatct
ggttgggtgagccggtccaatgatccacagatggtagctgaaaattttgtccctcctctg
ttggatgcagttctcattgattatcagagaaatgtcccagctgctagagaaccagaagtg
cttagtactatggctattattgtcaacaagttgggaggacatataacagctgaaatacct
caaatatttgatgctgtttttgaatgcacattgaatatgataaataaggactttgaagaa
tatcctgaacacagaacaaactttttcttactacttcaggctgtcaattctcattgtttc
ccagcattcctggctattccacctgcacagtttaaacttgttttggattccattatttgg
gctttcaaacataccatgaggaatgttgctgatacaggcttacagatactttttacacta
ttacaaaatgttgcacaagaagaagctgcagctcagagtttttatcaaacttatttttgt
gatattcttcagcatatcttttctgttgtgacagacacctcacatactgctggtttgaca
atgcatgcatcaatacttgcatatatgtttaatttggttgaagaaggaaaaataagtaca
ccgttaaatcctgggaatccagttaacaatcaaatgtttattcaggaatatgtggctaat
cttcttaagtctgcattccctcatctacaagatgctcaagtaaagctctttgtgacaggg
cttttcagcttaaatcaggatattcctgctttcaaggaacaccttagggatttcctagta
caaataaaggagtttgcaggtgaagatacatctgatctgtttttggaagaaagagaaaca
gcccttcgacaggctcaggaagagaaacataaacttcagatgtctgtccctggcatcctt
aatccacatgaaattccagaagaaatgtgtgattaa

DBGET integrated database retrieval system