KEGG   Hipposideros armiger (great roundleaf bat): 109377701
Entry
109377701         CDS       T04661                                 

Gene name
CASP1
Definition
(RefSeq) caspase 1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04217  Necroptosis
hai04621  NOD-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04625  C-type lectin receptor signaling pathway
hai05014  Amyotrophic lateral sclerosis
hai05132  Salmonella infection
hai05133  Pertussis
hai05134  Legionellosis
hai05135  Yersinia infection
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109377701 (CASP1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109377701 (CASP1)
   04623 Cytosolic DNA-sensing pathway
    109377701 (CASP1)
   04625 C-type lectin receptor signaling pathway
    109377701 (CASP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109377701 (CASP1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109377701 (CASP1)
   05135 Yersinia infection
    109377701 (CASP1)
   05133 Pertussis
    109377701 (CASP1)
   05134 Legionellosis
    109377701 (CASP1)
  09172 Infectious disease: viral
   05164 Influenza A
    109377701 (CASP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hai01002]
    109377701 (CASP1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109377701 (CASP1)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     109377701 (CASP1)
Peptidases and inhibitors [BR:hai01002]
 Cysteine peptidases
  Family C14: caspase family
   109377701 (CASP1)
Membrane trafficking [BR:hai04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    109377701 (CASP1)
SSDB
Motif
Pfam: Peptidase_C14 CARD GUCT
Other DBs
NCBI-GeneID: 109377701
NCBI-ProteinID: XP_019489681
LinkDB
Position
Un
AA seq 405 aa
MADKVLKEKRKLFVRSVGAGTINGLLDELLDQRVLNQEEMDKVRYENATVMDKARVLTDL
VILKGHEASQIFINQICEEDTYLAKMLGFSSGLQSENIPEPEAVILPILGNALQTVQNNP
AKPEFPGPEGSLKLCPPERAERIWREKSTEIYPIMERSTRTRLALIICNTEFDNLSRRDG
ADADIRGMRMLLESLGYTVDVKENLTAQEMTKELEAFAARKEHKTSDSTFVVFMSHGIRD
GICGKEYSGNVTEVLQINTIFQTLNTLKCPSLKDKPKVIIIQACRGGNQGMVWLQDSVKA
FEDSSAQTPEDLECDAIKRAHIEKDFIAFCSSTPDNVSWRHPTRGSLFIMKLIEHLKEYA
WSCDLEEIFRKVRFSFDLPDCKAQIQMPTAERVTLTKCFYLFPGH
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggctgacaaggtcctgaaagagaagaggaagctgtttgtccgttcagtgggtgcgggc
acaataaatggcctgttggatgaactattagaccagagagtgctgaaccaggaggagatg
gacaaagtaagatatgaaaatgctacagttatggataaggcccgagttttgactgacctt
gtcattctgaaagggcacgaggcaagccaaatatttatcaatcagatttgtgaagaggac
acctaccttgcaaagatgctggggttctcctcaggtctacagtctgaaaatattccagaa
cccgaagcagtgattcttcccatcctgggtaatgctcttcagacagtgcaaaacaaccca
gctaagcctgaattcccaggaccagaagggagcctcaagctttgtcccccagaaagagct
gaaaggatatggagagaaaagtcaacagagatttacccaataatggaaagatcaactcgc
acacgtcttgccctcattatctgcaacacagagtttgacaatctttctaggagagatgga
gctgatgctgatatcagaggtatgaggatgctattagaaagtctgggatacaccgtggat
gtaaaagaaaatctcactgctcaggaaatgactaaagagctggaggcatttgctgcccgc
aaggagcacaagacctctgacagtactttcgtggtgttcatgtctcatggtattcgggat
ggcatttgtggaaaggaatactctggaaatgtcacagaagtattacaaatcaacaccatc
tttcaaactttgaacaccttgaaatgtccaagtttgaaggacaaacccaaggtgatcatt
atccaagcctgccgtggtgggaaccaagggatggtgtggttacaagattcagtaaaagct
tttgaagacagctccgcccaaactccagaagatttggagtgtgatgccattaagagagcc
catatagagaaggattttattgctttctgttcttcaacaccagataatgtttcttggaga
catcccacacggggctctctttttattatgaaactcattgaacatttgaaagaatatgcc
tggtcctgtgacctagaggaaattttccgaaaggtccgattttcatttgacttaccagat
tgtaaggcacagatacagatgcccactgctgaaagagtgacactgacaaaatgtttctac
ctctttccaggacattaa

DBGET integrated database retrieval system