KEGG   Hipposideros armiger (great roundleaf bat): 109378262
Entry
109378262         CDS       T04661                                 

Definition
(RefSeq) uncharacterized LOC109378262
  KO
K10785  T-cell receptor beta chain V region
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04064  NF-kappa B signaling pathway
hai04514  Cell adhesion molecules
hai04612  Antigen processing and presentation
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05135  Yersinia infection
hai05142  Chagas disease
hai05144  Malaria
hai05150  Staphylococcus aureus infection
hai05162  Measles
hai05166  Human T-cell leukemia virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05202  Transcriptional misregulation in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109378262
   04015 Rap1 signaling pathway
    109378262
   04064 NF-kappa B signaling pathway
    109378262
   04020 Calcium signaling pathway
    109378262
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109378262
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    109378262
   04660 T cell receptor signaling pathway
    109378262
   04658 Th1 and Th2 cell differentiation
    109378262
   04659 Th17 cell differentiation
    109378262
   04672 Intestinal immune network for IgA production
    109378262
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109378262
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109378262
  09163 Immune disease
   05310 Asthma
    109378262
   05322 Systemic lupus erythematosus
    109378262
   05323 Rheumatoid arthritis
    109378262
   05320 Autoimmune thyroid disease
    109378262
   05321 Inflammatory bowel disease
    109378262
   05330 Allograft rejection
    109378262
   05332 Graft-versus-host disease
    109378262
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109378262
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109378262
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109378262
   05150 Staphylococcus aureus infection
    109378262
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109378262
   05170 Human immunodeficiency virus 1 infection
    109378262
   05162 Measles
    109378262
   05169 Epstein-Barr virus infection
    109378262
  09174 Infectious disease: parasitic
   05144 Malaria
    109378262
   05142 Chagas disease
    109378262
SSDB
Motif
Pfam: V-set Ig_3 I-set ig
Other DBs
NCBI-GeneID: 109378262
NCBI-ProteinID: XP_019490245
LinkDB
Position
Un
AA seq 257 aa
MELRPLLEPALQVSVMGSGRAPGESKTRGEQGAPALRNIDKLWGWPPAPNPAGPSLHSQL
HLLHREMHRMGGGLVQWSLRQWCRVPVGTYKDSDITMVTSQASPPNRAKGGTNFCSLTRK
TRAPSMEMASLTLSASARGTRLLCCVALCLLEAGSVDAGVTQSPTHLIKRRDGKAVLICH
PMSGHDTVSWYQQAQGQGLQFLIQYYEKEERERGNIPDRFSAQQFNNYSSELTMNNLQLE
DSAVYLCASSLDTALQG
NT seq 774 nt   +upstreamnt  +downstreamnt
atggagttaaggcctctcttggagcctgctctccaggtgagtgttatgggctccggtagg
gcacctggagaatccaagaccagaggagaacaaggagcacctgctctgaggaacatagac
aagctgtggggatggccacctgccccaaaccctgccgggcccagtctgcacagccagcta
cacctgctccatagggagatgcacagaatggggggtggcctggtccagtggagcctgcgg
caatggtgcagggtgcctgtgggaacctacaaagacagtgacatcacaatggtgacatca
caggcaagccctccaaacagagcaaagggaggaacaaacttctgctctctcacccgaaag
accagagccccaagtatggagatggccagccttaccctgtctgcatctgccaggggcacc
cggctcctctgctgcgtggccctctgtctcctggaggcaggttcagtggatgctggagtc
acccagtccccaacacacctaatcaaacgccgtgacgggaaggccgttctgatatgccac
cccatgtctggacacgatactgtgtcctggtaccagcaggctcaggggcagggcctccaa
ttcctcattcagtattatgagaaggaggagagagagagaggaaacatccctgatcgcttc
tcagctcaacagttcaacaactacagctcagagctgaccatgaacaacttgcagctggaa
gactcggctgtgtatctctgtgccagcagcttagacacagccctgcagggttaa

DBGET integrated database retrieval system