KEGG   Hipposideros armiger (great roundleaf bat): 109378365
Entry
109378365         CDS       T04661                                 

Gene name
PLCG2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00562  Inositol phosphate metabolism
hai01100  Metabolic pathways
hai01521  EGFR tyrosine kinase inhibitor resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04020  Calcium signaling pathway
hai04062  Chemokine signaling pathway
hai04064  NF-kappa B signaling pathway
hai04066  HIF-1 signaling pathway
hai04070  Phosphatidylinositol signaling system
hai04072  Phospholipase D signaling pathway
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04380  Osteoclast differentiation
hai04611  Platelet activation
hai04613  Neutrophil extracellular trap formation
hai04625  C-type lectin receptor signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04670  Leukocyte transendothelial migration
hai04722  Neurotrophin signaling pathway
hai04750  Inflammatory mediator regulation of TRP channels
hai04919  Thyroid hormone signaling pathway
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05171  Coronavirus disease - COVID-19
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05214  Glioma
hai05223  Non-small cell lung cancer
hai05225  Hepatocellular carcinoma
Module
hai_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109378365 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109378365 (PLCG2)
   04014 Ras signaling pathway
    109378365 (PLCG2)
   04370 VEGF signaling pathway
    109378365 (PLCG2)
   04064 NF-kappa B signaling pathway
    109378365 (PLCG2)
   04066 HIF-1 signaling pathway
    109378365 (PLCG2)
   04020 Calcium signaling pathway
    109378365 (PLCG2)
   04070 Phosphatidylinositol signaling system
    109378365 (PLCG2)
   04072 Phospholipase D signaling pathway
    109378365 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109378365 (PLCG2)
   04613 Neutrophil extracellular trap formation
    109378365 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    109378365 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    109378365 (PLCG2)
   04662 B cell receptor signaling pathway
    109378365 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    109378365 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    109378365 (PLCG2)
   04670 Leukocyte transendothelial migration
    109378365 (PLCG2)
   04062 Chemokine signaling pathway
    109378365 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    109378365 (PLCG2)
   04919 Thyroid hormone signaling pathway
    109378365 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109378365 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109378365 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    109378365 (PLCG2)
   04380 Osteoclast differentiation
    109378365 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109378365 (PLCG2)
   05206 MicroRNAs in cancer
    109378365 (PLCG2)
   05205 Proteoglycans in cancer
    109378365 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109378365 (PLCG2)
   05214 Glioma
    109378365 (PLCG2)
   05223 Non-small cell lung cancer
    109378365 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109378365 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109378365 (PLCG2)
   05171 Coronavirus disease - COVID-19
    109378365 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109378365 (PLCG2)
   05169 Epstein-Barr virus infection
    109378365 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109378365 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109378365 (PLCG2)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     109378365 (PLCG2)
Membrane trafficking [BR:hai04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    109378365 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    109378365 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 SH3_9 C2 SH3_2 PH_12 PH PH_14 EF-hand_like
Other DBs
NCBI-GeneID: 109378365
NCBI-ProteinID: XP_019490318
LinkDB
Position
Un
AA seq 1213 aa
MPTMVNVDALPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGNQFILSTLSLAADSKEDAT
KWLSGLKILHQEVMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTVLPMVNFKMSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFDQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFIDEFLMYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRYMARV
FKEVFGDLLLMRPTEASADQLPSPSQLREKIIIKHKKLGPRGDIDVNMEDKKDEHKQQGE
LYMWDAIDQKWTRHYCAIADAKLSFSDDIEQTMEDELPQDTPPTELHFGEKWFHKKVEKR
ISAEKLLQEYCNETGGKDGTFLVRESERFPNDYTLSFWRSNRVQHCRIRSTMEGGIMKYY
LTDNLMFTSIYALIQHYRETHLRCADFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEISPSMPQRTVKALYDY
KAKQSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTVDVEELEKQII
EDSPLGSLCRGILDLNTYNVVLKLKMVGPKQENNMKYWEKNQSIAIELSDLVVYCKPTSK
TKDNLENPDFREIRSFVETKADSVVRQKPIELLKYNQKGLTRVYPKGQRVDSSNYDPFRL
WLCGSQMVALNFQTADKYMQMNQALFSLNGRTGYVLQPESMRNEKYDPMPPESQRKILMT
LTVKVSPPLLLPGSQGCVALGGCMPVPSDDTCRLVYTILQGHFRGEREGERDLKLMNIEM
VFPGVGWAGQMGPLISFDHLPDDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEEDMFS
DPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLVSGETCWGSLRFI
SWWGWKWPMSIVD
NT seq 3642 nt   +upstreamnt  +downstreamnt
atgcccaccatggtcaacgtggacgcccttccggaatatgagaagagtcagatcaagaga
gccctggagctgggcacagtgatgaccgtcttcagcttccgcaagtccaccccggagcgg
aggaccgtccaggtgatcatggagacgcggcaggtggcctggagtaagacggctgacaaa
atcgagggcttcttggatatcatggaaataaaggaaatccgcccagggaagaactccaag
gattttgagcgtgcaaaggcagtccgccagaaggaagactgctgttttaccatcttgtat
ggcaaccagttcatcctcagcacactcagtttagcagctgactctaaggaagatgcaact
aagtggctctccggcttgaaaatcttacaccaggaagtgatgagcgcgtcgacacctacc
attatcgagagttggctgagaaagcagatctattctgtggatcaaaccaggagaaacagc
atcagcctccgagagttgaagactgtcttgcctatggtcaacttcaaaatgagcagtgcc
aagttcctcaaagataagtttgtggaaattggcgcgcacaaagatgaactcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaccagcaaaaatcgattcttgatgaa
ttcaagaaagattcctctgtgttcatcttgggcaacactgaccggccggatgcctctgcc
gttcacctgcacgacttccagcggtttctcttacatgaacagcaggagctttgggctcag
gatctgaacaaagtccgggagcgaatgacaaaatttatcgacgacacgatgagggagact
gccgagccttttctgtttatcgatgagttcctcatgtatctgttttcacgggagaacagc
atttgggatgaaaaatatgatgtggtggacatgcaggacatgaacaaccccttgtctcat
tactggatctcctcatcacataacacgtacctcacaggtgaccagctgcggagtgagtca
tccccagaagcatacatccgctgtctgcgcatgggctgtcgctgcattgaactggactgc
tgggatgggccggatgggaagcccatcatctaccacggctggacacggaccacaaagatc
aagtttgatgacgtcgtgcaagccatcaaagaccatgcctttgtgacctcgagcttcccg
gtgatcctgtccattgaggagcactgtagcgtggaacagcagcgctacatggccagagtg
ttcaaagaggtgttcggcgacttgctgctgatgaggcccacggaggccagtgctgaccag
ctgccctcacccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggtgacatagatgtcaatatggaggacaagaaggatgagcacaagcagcagggtgaa
ctgtacatgtgggatgccatcgaccagaaatggactcggcactactgcgccattgcggat
gccaagctgtccttcagcgatgacattgaacagactatggaagacgaactgccccaggat
acccctcccacagagctgcattttggagagaagtggttccataagaaggtggagaagagg
ataagtgctgagaagctgctgcaggaatactgcaacgaaacggggggcaaggatgggacc
ttcttggtgcgggagagcgagaggttccccaatgactacaccctgtccttctggcggtcc
aaccgggttcagcactgccggatccgctccaccatggagggcgggatcatgaagtactac
ctgactgacaacctcatgttcaccagcatctatgccctcatccagcactaccgtgagaca
cacctgcgctgtgccgacttcgagctccggctcactgaccctgtgcccaaccccaacccc
catgaatcaaagccgtggtactacgatgggctgagccgtggagaagcggaggacatgctg
atgagggttccccgggatggggcctttctcatccggaaacgggaaggtagcgactcctac
gccatcaccttcagggccaggggcaaggtgaagcactgtcgcatcaaccgggatggccgg
cactttgtgctggggacctccgcctacttcgagagtctggtggagctcgtcagttactac
gagaagcacgcgctctaccgaaagatgagactgcgctaccccgtgacccctgagctcctg
gaacgctacaatatggaaagagatataaactccctgtatgacgtcagcagaatgtatgtg
gatcccagtgaaatcagcccttctatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcagagtgatgagctgagcttctgccgtggtgccctcattcacaacgtctcc
aaggagcccgggggctggtggaaaggagactatggaaccagaatccaacagtacttcccg
tcgaattacgtcgaggacatttccacagttgacgtggaggagctggagaaacagattatt
gaagacagtcctttagggagtctttgcagaggaatactggatctcaacacctataacgtt
gtactgaaactaaagatggttggccccaaacaggaaaacaacatgaagtactgggagaag
aaccagtccatcgccatcgaactctcggacctggtcgtctactgcaaaccaaccagcaag
accaaggacaatttagaaaaccctgacttccgagaaatccgctcctttgtggagacgaag
gctgacagcgtcgtcagacagaaacccatcgagctcctgaagtacaatcaaaagggcctg
acccgcgtgtacccgaagggacagagggtggactcctccaactacgatcccttccgcctc
tggctctgcggctcccaaatggtggcgctcaatttccagactgcagataaatacatgcag
atgaaccaggccctgttttcacttaatgggcggacgggctacgtcctacagcctgagagc
atgaggaatgagaaatacgaccccatgccgcccgagtcccagagaaagatcctgatgact
ctgacggtcaaggtaagcccccctctcctcctcccagggagtcagggctgtgtggcattg
ggagggtgcatgcctgtacctagtgatgatacctgtcgtcttgtttacaccatcctccag
ggtcattttagaggggaaagggagggggagagagatttaaagctgatgaatatagagatg
gtttttccaggagtggggtgggcaggacaaatggggcctctaataagctttgatcacctt
ccagacgacaatggcctaagcccagtttgggctccaacacaggagaaggtgacatttgaa
atttatgacccaaacctcgcatttctgcgctttgtggtgtatgaggaagatatgttcagc
gatcccaactttctggctcatgctacttaccccattaaaggcatcaaatcaggatttaga
tctgttcctctgaagaacgggtacagcgaagacattgagctggcttccctcctggttttc
tgtgagatgcggccagtcctggtgagtggagaaacgtgttggggttccctgagatttatc
agctggtgggggtggaagtggcccatgagtatagttgactga

KEGG   Hipposideros armiger (great roundleaf bat): 109379925
Entry
109379925         CDS       T04661                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00562  Inositol phosphate metabolism
hai01100  Metabolic pathways
hai01521  EGFR tyrosine kinase inhibitor resistance
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04062  Chemokine signaling pathway
hai04064  NF-kappa B signaling pathway
hai04066  HIF-1 signaling pathway
hai04070  Phosphatidylinositol signaling system
hai04072  Phospholipase D signaling pathway
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04613  Neutrophil extracellular trap formation
hai04650  Natural killer cell mediated cytotoxicity
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04670  Leukocyte transendothelial migration
hai04722  Neurotrophin signaling pathway
hai04750  Inflammatory mediator regulation of TRP channels
hai04919  Thyroid hormone signaling pathway
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai05012  Parkinson disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05135  Yersinia infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05170  Human immunodeficiency virus 1 infection
hai05171  Coronavirus disease - COVID-19
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05214  Glioma
hai05223  Non-small cell lung cancer
hai05225  Hepatocellular carcinoma
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
hai_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109379925 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109379925 (PLCG1)
   04014 Ras signaling pathway
    109379925 (PLCG1)
   04015 Rap1 signaling pathway
    109379925 (PLCG1)
   04370 VEGF signaling pathway
    109379925 (PLCG1)
   04064 NF-kappa B signaling pathway
    109379925 (PLCG1)
   04066 HIF-1 signaling pathway
    109379925 (PLCG1)
   04020 Calcium signaling pathway
    109379925 (PLCG1)
   04070 Phosphatidylinositol signaling system
    109379925 (PLCG1)
   04072 Phospholipase D signaling pathway
    109379925 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    109379925 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    109379925 (PLCG1)
   04660 T cell receptor signaling pathway
    109379925 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    109379925 (PLCG1)
   04659 Th17 cell differentiation
    109379925 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    109379925 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    109379925 (PLCG1)
   04670 Leukocyte transendothelial migration
    109379925 (PLCG1)
   04062 Chemokine signaling pathway
    109379925 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    109379925 (PLCG1)
   04919 Thyroid hormone signaling pathway
    109379925 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109379925 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109379925 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    109379925 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109379925 (PLCG1)
   05206 MicroRNAs in cancer
    109379925 (PLCG1)
   05205 Proteoglycans in cancer
    109379925 (PLCG1)
   05231 Choline metabolism in cancer
    109379925 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109379925 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109379925 (PLCG1)
   05214 Glioma
    109379925 (PLCG1)
   05223 Non-small cell lung cancer
    109379925 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109379925 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    109379925 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109379925 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109379925 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109379925 (PLCG1)
   05171 Coronavirus disease - COVID-19
    109379925 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109379925 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109379925 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109379925 (PLCG1)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     109379925 (PLCG1)
Membrane trafficking [BR:hai04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    109379925 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    109379925 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 109379925
NCBI-ProteinID: XP_019492475
LinkDB
Position
Un
AA seq 1291 aa
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFAQLYRNLMYSAQKTMDLPFLETTALRP
GERPELCRVSLPMFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWKSQLDTVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIVADGLPSPNQLKKKILIKHKKLAEGSAYEEVPASVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQRDDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLW
FPSNYVEELVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAQWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVTGLKTGYRAVPLKNNYSEDL
ELASLLVKIDIFFTKQENGDLSPFSGVSLRERGSEASGQLFHGRAREGSFEARYQQPFED
FRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3876 nt   +upstreamnt  +downstreamnt
atggcaggcgctgcgtccccctgcgccaatggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctttgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggcccgagcggaagaccttccaggtcaagctggagacgcggcagatc
acgtggagccgcggcgccgacaagatcgagggggccattgacattcgcgaaatcaaggag
atccgcccagggaagacctcacgggactttgatcgctaccaagaggaccctgctttccga
cccgaccagtcacactgctttgtcatcctgtatggaatggagttccgcctgaagaccctc
agcctgcaagctacatctgaggatgaagtgaacatgtggatcaagggcttgacctggctg
atggaggacacactgcaggcggccacccccttacagattgaaaggtggctgcggaaacag
ttctactctgtggatcggaatcgcgaggaccgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgtttcctccgagagcggctaacagac
ctggagcagcgcagcagtgacatcacctatgggcagtttgctcagctgtaccgcaacctc
atgtacagcgcccagaagacgatggatctccccttcttggaaaccactgccctgaggccg
ggggagcggccagagctctgccgagtgtctcttcctatgttccagcagtttctcctcgag
taccagggggagctgtgggctgttgaccggctccaggtgcaggaattcatgctcagcttc
ctccgagaccccttgcgagaaatcgaggagccatacttcttcttggatgagtttgtcacc
ttcctgttctccaaagagaacagtgtgtggaagtcgcagctggacacggtgtgcccggac
accatgaacaatccgctctcccactactggatctcctcctcacacaacacgtacctgacc
ggggaccagttctccagcgagtcctccctggaagcctatgctcgctgcctgcgcatgggc
tgtcgctgcattgagttggactgctgggatggcccggacgggatgccggtcatttaccat
ggacacacccttaccaccaagatcaagttctcagatgtcctgcacaccatcaaggagcat
gcttttgtggcctcagagtacccggtcatcctgtccatcgaggaccactgcagcattgcc
cagcagaggaacatggcccagtacttcaagaaggtgctgggagacacactcctcaccaag
cccgtggacatcgttgccgacggtctcccgtcccccaaccagctcaagaagaaaatcctt
atcaagcacaagaagctggctgagggcagtgcctatgaggaggtgcctgcgtccgtgatg
tactctgagaacgacatcagcaactctatcaagaatggcatcctctacctagaggatccc
gtgaaccatgagtggtacccccactacttcgttctgaccagcagcaagatctactactcc
gaggagaccagcagtgaccagggcaacgaggacgaggaagagcccaaagaggccagtggc
agcacagagctgcactccaacgagaagtggttccacgggaagctcggggcaggacgggac
gggcggcacattgccgagcgcctgctcaccgagtactgcatcgagacgggggcccccgac
ggctccttcctggtgcgcgaaagcgagaccttcgtgggcgactacaccctctctttctgg
cggaacgggaaagtccagcactgccggatccactcccggcaagatgccgggacccccaag
ttcttcttgacagacaacctcgtctttgactcactctatgacctcatcacacactaccag
caggtgcccctgcgctgcaacgaatttgagatgcgcctctcggagcccgtcccgcagacc
aatgcccacgagagcaaagagtggtaccacgccagcctgaccagggcgcaggccgagcac
atgctgatgcgtgtcccccgcgatggggccttcctggtgcggaaacgcaacgagcccaac
tcctacgccatttccttccgggctgagggcaagatcaagcattgccgcgtccagcaggag
ggccagacggtgatgctgggcaactcagagtttgacagcctcgtcgacctcatcagctac
tacgagaagcatccgctgtaccgcaagatgaagctgcgctaccccatcaacgaggaggcg
ctggagaagatcggcacagctgagcctgactacggggccctgtatgagggacgcaaccct
ggcttctatgtggaggcaaaccctatgccgactttcaagtgtgctgtcaaagccctcttt
gactacaaggcccagagagatgacgagctgacttttaccaaaagcgccatcatccagaac
gtggagaagcaggatggaggctggtggcggggagactatggtgggaagaagcagctgtgg
ttcccatcaaactacgtggaagagctggtcagccctgcagccctggagcccgagagggag
cacttggatgaaaacagccccctgggggacttgctgcggggggtcttggatgtgccagct
tgtcagattgccatccgtcccgagggcaagaacaaccggctcttcgtcttctccatcagc
atggcgtcggtggcgcagtggtccctggatgtcgccgctgactcacaggaagagctgcag
gactgggtgaaaaagatccgtgaagtggcccagactgcagacgccaggctcacggagggg
aagatgatggagcggaggaagaagatcgccctggagctctcggagcttgtcgtctactgc
cggcctgttccctttgatgaagagaagattggcacagaacgtgcctgctaccgtgacatg
tcgtccttcccggagaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttc
ctccagtacaaccggctgcagctctcgcgcatctaccccaagggccagcggctggactcc
tccaattatgaccccttgcccatgtggatctgtggcagtcagctggtcgccctcaacttc
cagaccccagataagcctatgcagatgaaccaggccctcttcatgaccggtgggcactgc
ggctacgtgctgcagcccagcaccatgcgggacgaggcctttgacccctttgacaagagc
agcctccgtgggctggagccatgcgccatctgcattgaggtgctgggagcccggcatctg
cccaagaatggccgaggcattgtgtgtccctttgtggagattgaggtggcaggagccgag
tatgacagcaccaagcagaagacggagtttgtggtggacaatggcctgaaccctgtgtgg
ccggccaagcccttccacttccagatcagtaaccctgaattcgccttcctgcgctttgtg
gtttatgaagaggacatgtttagtgaccagaacttcctggctcaggctaccttcccggtg
acaggcctcaagacagggtacagagcagtgcctttgaagaacaactatagtgaggacttg
gagttggcctccctgctggtcaagatagacattttctttaccaagcaggagaatggcgac
ctcagtcccttcagcggtgtgtccctgcgtgagcggggctccgaggcctcgggccagctg
ttccatggccgggcccgggaaggctcctttgaagcccgctaccagcagccgtttgaggat
tttcgcatctcccaggagcatctcgcggaccattttgacagtcgggagcgaagggcccca
cgaaggactcgggtcaacggagacaaccgcctctag

DBGET integrated database retrieval system