KEGG   Hipposideros armiger (great roundleaf bat): 109379054
Entry
109379054         CDS       T04661                                 

Gene name
CPSF4
Definition
(RefSeq) cleavage and polyadenylation specific factor 4
  KO
K14404  cleavage and polyadenylation specificity factor subunit 4
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03015  mRNA surveillance pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    109379054 (CPSF4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109379054 (CPSF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hai03021]
    109379054 (CPSF4)
   03019 Messenger RNA biogenesis [BR:hai03019]
    109379054 (CPSF4)
Transcription machinery [BR:hai03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     109379054 (CPSF4)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     109379054 (CPSF4)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 Torus zf-CCCH_3 zf-CCCH_4 zf-CCCH_2
Other DBs
NCBI-GeneID: 109379054
NCBI-ProteinID: XP_019490874
LinkDB
Position
Un
AA seq 316 aa
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHTLPRSQPGVAELGL
SPGVSVLFSPLSCGLGGRDEPTATPCPALDLNCRWEPPSSPHCRSRRSLRQSREPRRSSG
SCRVKTAVQATGDPGRWSRSPVTSVVKKDTTPTDAPKGIWPFSVDSDSSWSQLKAAQGPC
CWGPLQAILGSVHLTV
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcaggaaatcatcgccagcgtggaccatatcaagttcgacttggagatcgcggtggag
cagcagctcggggcgcagccgctgcccttccccggcatggacaaatcgggggctgctgtc
tgcgaattctttttgaaagcggcctgtggcaaaggaggcatgtgcccattccgccacatt
agcggcgagaagacagtggtgtgcaaacactggctgcgggggctgtgtaagaagggggac
cagtgcgagttcctgcacgagtatgacatgaccaagatgcctgagtgttatttctactca
aagttcggagagtgcagcaacaaggagtgccccttcctgcacatcgaccccgagtccaag
atcaaggactgcccttggtacgaccgtggcttctgcaagcacggtcccctgtgtaggcac
cggcacacgcggagagtcatctgtgtgaattacctggtgggattctgcccagaggggccc
tcgtgtaaattcatgcacactctccccaggtctcagccaggtgtggcagagctgggtctg
agcccaggtgtgtcagttctgttctccccactgtcctgtggcctcgggggcagagatgag
ccaacagccacgccatgtccagccctcgatttgaactgccgatgggaaccaccgagcagc
ccccactgccgcagcagacgcagcctccgacaaagcagagaaccccgcaggtcatcgggg
tcatgcagagtcaaaacagcagtgcaggcaaccggggaccccggccgttggagcaggtca
cctgttacaagtgtggtgaaaaaggacactacgccaacagatgcaccaaagggcatttgg
cctttctcagtggacagtgacagcagctggagccagctcaaagcagcccaagggccctgt
tgttggggaccactccaggccatccttgggagcgtgcatttaactgtttaa

KEGG   Hipposideros armiger (great roundleaf bat): 109387207
Entry
109387207         CDS       T04661                                 

Gene name
CPSF4L
Definition
(RefSeq) cleavage and polyadenylation specific factor 4 like
  KO
K14404  cleavage and polyadenylation specificity factor subunit 4
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03015  mRNA surveillance pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    109387207 (CPSF4L)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109387207 (CPSF4L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hai03021]
    109387207 (CPSF4L)
   03019 Messenger RNA biogenesis [BR:hai03019]
    109387207 (CPSF4L)
Transcription machinery [BR:hai03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     109387207 (CPSF4L)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     109387207 (CPSF4L)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 Torus zf-CCCH_3 zf-CCCH_2 zf-CCCH_4 zf-C3H1
Other DBs
NCBI-GeneID: 109387207
NCBI-ProteinID: XP_019506497
LinkDB
Position
Un
AA seq 184 aa
MGTGLVMSVHMLCVGLGTSRESGSAVCNFFTKGLCEKGKLCPFRHDHGEKMVVCKHWLRG
LCKKGDQCKFLHQYDVTRMPECYFYSKFGECSNKECSFLHMKPAFKTQDCPWYDQGFCKD
GPLCKYRHVHRIMCINYLAGFCPEGPKCQSAHFSTGHGVQHLLLLPGDLASPLPQWIACV
SPLR
NT seq 555 nt   +upstreamnt  +downstreamnt
atgggcacaggtttggtaatgtctgtgcacatgctgtgtgtgggtttgggaacaagccga
gagtcgggctcagccgtgtgcaatttcttcactaaaggactctgtgagaaagggaagctc
tgcccgttccggcacgaccacggggagaagatggtagtgtgtaagcactggctccggggc
ctgtgcaagaagggcgaccaatgcaagttcctgcaccagtacgatgtcaccaggatgcct
gagtgctacttctactccaagttcggtgaatgcagcaacaaggaatgttcctttcttcac
atgaagccagctttcaagacccaggactgtccttggtacgaccaaggtttctgcaaggat
ggtcccctgtgtaaataccgccatgtccacaggataatgtgcattaactacttagctggc
ttctgccctgagggacccaagtgccaatctgctcacttctcaactggccacggggttcag
caccttctgcttctgcctggggacctcgcaagcccccttccccaatggattgcctgcgtc
tcccccctcagatga

DBGET integrated database retrieval system