KEGG   Hipposideros armiger (great roundleaf bat): 109379163
Entry
109379163         CDS       T04661                                 

Gene name
RNASEL
Definition
(RefSeq) ribonuclease L
  KO
K01165  ribonuclease L
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04621  NOD-like receptor signaling pathway
hai05160  Hepatitis C
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109379163 (RNASEL)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109379163 (RNASEL)
   05160 Hepatitis C
    109379163 (RNASEL)
   05168 Herpes simplex virus 1 infection
    109379163 (RNASEL)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank Ribonuc_2-5A Pkinase PK_Tyr_Ser-Thr Kdo Choline_kinase RIO1
Other DBs
NCBI-GeneID: 109379163
NCBI-ProteinID: XP_019491095
LinkDB
Position
Un
AA seq 725 aa
MDTKSHTHPQERPTRSNNGKTSAEGNRSLIQAVEGRNIELVKELLERGADVNVQEKKWGW
TPLLTAVRSGREDTVDLLLGYGADPCLRKRNGATPFIVAGIVGNVKLLELFLSKGADINE
SDKHGFTAFMEAACYGKVEALRFLYENGAQVNLGRKTMEDQERLRKGGATALMDAAEKGH
VDVVKILLDEMGADVKARDNMGRNALIRALRNADDSKIEAITRLLLDRGADVNVRGEKGK
TPLILAVEKKHIGLVKMLLEQEDIEIDETDREGKTALLLAVELQQTEIVRLLCQNGASTD
CGDLIRIAKRNYDNALSEFLLDHGAREDFHPPTEDWEPQSLHWGQALKHLHNMYRPMIGK
LKIFIDEEYKIADTSEGGIYLGFYDGQEVAVKRFSEDSPCGQKEVSCLQSIRANSDLVTF
YGSETHGGCLYVCMSLCEQTLEKHLAEPREEAVGKEEDKFAQNTLLSIFKAVEELHLRCG
YTHQDLQPQNILIDSNNAVRLADFDKSIKWAGEPEEIKSDLKALGLLVLYVIKGGDILFE
TLKTKSDEEVIQRSPNEEIQNLIHHLFCPGENVKDHLSGLLDHPFFWSWESRYRMLRDVG
NESDIKTRNQESEILRLLDSGLSECRRSFYEWTTKIDSYVMEEMNKFYEKRRNFYQNTVG
DLLKFIRNLGAHIDEDKNKWMKSRIGDPSQYLQETFPDLVIYVYMKLQNSEYRKYFPKTH
QEALA
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggataccaagagccatactcacccccaggagagacccacacgctccaacaatggaaag
acttcagcggagggtaaccgttcattgatacaagctgttgaaggtagaaacattgagctg
gtcaaggaattgctagaaagaggggctgacgtcaatgtccaggaaaagaaatggggctgg
acgcctctgcttactgcagtacgaagtggcagggaggacactgtggaccttctgcttggt
tatggtgctgacccttgtctcaggaagaggaatggggccactcccttcatcgtcgctggg
atcgtgggaaatgtgaagctgctcgagcttttcctttctaaaggcgcagatatcaacgag
tctgacaagcacggctttacagctttcatggaagctgcttgctatggtaaggtggaagcc
ttgagattcctatatgagaatggagcacaggtaaatttgggccgaaagacaatggaggat
caagagaggctcaggaaaggaggggccacagctctcatggatgctgctgaaaagggacat
gtagatgtcgtgaagatcctccttgacgagatgggggccgatgtcaaagccagggacaac
atgggccgaaatgctttgatccgtgctcttcggaacgctgatgacagcaagatagaggcc
atcactcgccttctgctggaccgcggggctgatgtcaatgtgaggggagaaaaagggaag
acgcccctgattctggcagtggaaaagaagcacatcggtttggtaaagatgcttctagaa
caagaagatatagagattgatgagacagacagagagggcaaaacagcactcttgttggct
gtcgaactccaacagacagaaattgtccggttactgtgtcaaaatggagccagcacggat
tgtggagatcttattaggatagcaaagcgcaattatgacaatgctctttctgagtttctt
cttgatcatggagccagagaagattttcaccctcccactgaagactgggaacctcagagc
ttacattgggggcaggccctgaaacacctccacaacatgtatcgccctatgataggcaaa
ctcaagatctttattgatgaagaatataaaattgctgacacgtcagaagggggcatctac
ctcggcttctatgatggccaagaggtagctgtgaagcgattctcggaagatagcccatgt
ggacaaaaggaagtgtcctgtctccagagcatccgagcgaacagtgacctggtgacattc
tatggcagtgagacccacgggggctgtctgtatgtgtgcatgtccctctgtgagcagacg
ctggagaagcacttggctgagcccagagaggaggcggtgggaaaagaggaagataagttt
gcccaaaacaccctcttatctatatttaaggctgttgaagagctccacctgaggtgtgga
tacactcaccaggatctgcagccacagaacatcttaatagattccaataacgctgttcgc
ctggcagattttgataaaagcatcaagtgggctggagagccagaggaaatcaagagtgat
ctaaaggcccttggattgctggtcctatatgtgataaaggggggagacatcctttttgag
acgctgaagactaaaagcgatgaagaggtgattcaacgttctccaaatgaggaaattcag
aacctcattcatcacctcttctgccctggggaaaatgtgaaggaccatctgagtggcctg
ctggatcaccctttcttctggagttgggagagccgctataggatgcttagggatgtggga
aatgaatccgacatcaaaacacgaaatcaggagagtgagatcctccgactactggatagt
ggactatcagaatgtcgcagaagtttttacgagtggaccactaagattgacagctatgtt
atggaagaaatgaataagttttatgaaaagagacgcaatttctaccagaacactgtgggt
gatctgctaaagttcatccggaatttaggggcacacattgatgaagacaagaataaatgg
atgaagtccagaattggagacccttctcagtatctgcaggagacattccccgatctggtc
atctatgtctatatgaaactacagaactcagaatacagaaagtattttcccaaaactcac
caagaagccctggcatga

DBGET integrated database retrieval system