KEGG   Hipposideros armiger (great roundleaf bat): 109379436
Entry
109379436         CDS       T04661                                 

Gene name
EGF
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04072  Phospholipase D signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04510  Focal adhesion
hai04540  Gap junction
hai04630  JAK-STAT signaling pathway
hai04810  Regulation of actin cytoskeleton
hai05160  Hepatitis C
hai05165  Human papillomavirus infection
hai05200  Pathways in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05226  Gastric cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109379436 (EGF)
   04012 ErbB signaling pathway
    109379436 (EGF)
   04014 Ras signaling pathway
    109379436 (EGF)
   04015 Rap1 signaling pathway
    109379436 (EGF)
   04630 JAK-STAT signaling pathway
    109379436 (EGF)
   04066 HIF-1 signaling pathway
    109379436 (EGF)
   04068 FoxO signaling pathway
    109379436 (EGF)
   04020 Calcium signaling pathway
    109379436 (EGF)
   04072 Phospholipase D signaling pathway
    109379436 (EGF)
   04151 PI3K-Akt signaling pathway
    109379436 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109379436 (EGF)
   04540 Gap junction
    109379436 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109379436 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109379436 (EGF)
   05231 Choline metabolism in cancer
    109379436 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109379436 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109379436 (EGF)
   05212 Pancreatic cancer
    109379436 (EGF)
   05226 Gastric cancer
    109379436 (EGF)
   05214 Glioma
    109379436 (EGF)
   05218 Melanoma
    109379436 (EGF)
   05219 Bladder cancer
    109379436 (EGF)
   05215 Prostate cancer
    109379436 (EGF)
   05213 Endometrial cancer
    109379436 (EGF)
   05224 Breast cancer
    109379436 (EGF)
   05223 Non-small cell lung cancer
    109379436 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109379436 (EGF)
   05165 Human papillomavirus infection
    109379436 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109379436 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109379436 (EGF)
Cytokines and growth factors [BR:hai04052]
 Growth factors
  Growth factors (RTK binding)
   109379436 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b cEGF FXa_inhibition EGF_CA EGF EGF_3 hEGF Tr-sialidase_C
Other DBs
NCBI-GeneID: 109379436
NCBI-ProteinID: XP_019491538
LinkDB
Position
Un
AA seq 942 aa
MVIMMKDTHKSKEIRLLKNHEGIKHCPLSKYTSTSNKPSCLLDQKLCKLRKSNCRGSVCG
QDPKSHLCTCAEGYALSQDGKYCEDINECAFWNHGCTLGCENIPGSYYCTCPVGFVLLPG
GKRCHQLISCPINASECSHDCVLTSDGPICFCPEGSVLEADGKTCSGCSSPDNGGCSQLC
LPLSPVSWQCDCLPGYDLQLDKKSCVASGPQPFLLFANSQDIRHMHFDGTDYESLLSQQM
GTVFALDHDPVENKVYFAHTTLKWIERANMDGSQRERLIEDAVDVPEGLAIDWINRKLYW
TDRGKSVIEGSDLSGKHREIIIKEDISQPRGIAVHPMAKRLFWTDMGINPRIESSSLQGI
GRLVIASSELVWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRQRLAQNDVGRPFAVA
VFGDDVWFSDWTVPSVIRVNKRTGQNRVCLRGSMLKPSSLVVVHPLAKPGADPCLYQNGG
CEHICKQKFGTAQCSCREGFVKAPDGKMCLALNGHQISTGSETDLSQGTPSDILSSSPAL
EDNSTESRHMLVAEIMVSDDDDCGPVRCGIHSRCVSEGEVAMCQCLRGFAGDGKVCSDID
ECEMGITVCLHPSSKCINTEGSYVCQCSEGYRGDGTHCLDIDECQLDTHTCGENATCTNT
EGNYTCMCAGSLSEPGQMCPDSTALAPLREEGQYSVRNSYPECPPSHAGYCLHDGVCMYI
EAVDNYACNCVVGYVGERCQHRDLKWWELRHAGHGRQWDITVVAVCMVVLVLLLLLGLWG
THYYRTKKLLSKNPKNPYEESNREVSITRPADREAGMSSCPQPWFVVIKEHQNLSNGNQP
VTLQDGQAAGGGQFLSREPGSVQPTSWRKEPQVCLGTEQGCCNSPPSDNGSGPQGVESSF
SLPSYVARPIVVGAERPRSLLSANPLWQQRARDSPYQMEQNQ
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggtgatcatgatgaaggacacacataaaagcaaggagattagacttcttaagaaccat
gaagggatcaagcattgtcccctgtcaaaatacacctctacttcaaataaaccatcttgt
cttttagatcagaaactctgcaaactgaggaaaagcaactgcagaggcagcgtgtgtggg
caagaccctaagtcccacctgtgtacgtgtgcggaaggatatgctttaagccaggacgga
aagtactgtgaagatatcaacgaatgtgccttttggaatcatggctgtactcttgggtgt
gaaaacatccctggatcctattattgcacatgccccgtaggatttgttctgcttcctggt
gggaaacggtgtcaccaattaatttcctgcccaatcaatgcatctgagtgcagccatgac
tgtgttctgacttcagatggtcccatatgtttctgtcctgaaggctcagtgcttgaggca
gatggaaaaacgtgtagtggctgttcatcacctgataatggtggatgtagccagctctgc
cttcctctcagcccagtgtcctggcagtgtgattgtcttcctgggtatgacttacaactg
gataaaaaaagctgtgtagcttcaggaccacaaccgtttttgctgtttgccaattctcaa
gatattcgacacatgcattttgatggaacagattatgaaagcctgctcagccagcaaatg
ggaacagtttttgccctagatcatgaccctgtggaaaataaggtatactttgcccataca
accctgaagtggatagagagagccaatatggatggttctcagcgagaaaggcttatcgag
gacgcagttgatgtgccagaaggtcttgcgatagattggattaaccgtaaactctattgg
acagacagagggaaatctgtcattgaaggcagtgatttaagtggaaaacatcgtgaaata
atcattaaggaggacatctctcagccacgaggaattgctgttcatccaatggccaagaga
ttattctggactgatatggggattaatccacgaattgaaagttcttcccttcaaggcatt
ggccgactggttatcgctagctctgagctggtctggcccagcggaataacgattgatttc
ttaactgataaattgtattggtgcgatgccaagcagtctgtgattgaaatggccaatctg
gacggttcgaaacgccaaagacttgcccagaacgatgtaggtcgaccatttgctgtggcc
gtgtttggggatgacgtgtggttctctgactggactgtgccatcggtaataagggtgaac
aagaggactggccaaaatagggtatgtctccgaggcagcatgctgaagccctcatcactg
gttgtagttcatccattggcaaaaccaggagcagatccctgcttatatcaaaatggaggc
tgtgaacatatttgcaaacagaagtttggaactgctcagtgttcgtgtcgtgaaggtttt
gtgaaagccccagatgggaaaatgtgtctggctctaaatggccatcagatatcgacaggt
agtgaaacagacctaagtcaaggaacgccatcggacatcctatccagcagtccagcatta
gaagataacagcacagaatcccgacatatgctagtggccgaaatcatggtgtcagatgac
gacgactgtggtcctgtgagatgtggtatccactctcgatgtgtttcagagggagaagtt
gccatgtgtcagtgtttgagaggatttgctggggatggaaaagtatgttctgatatagat
gaatgtgagatgggtatcacagtttgcctacatccctcctccaagtgcatcaatactgaa
ggcagctatgtctgccagtgctctgaaggctaccgaggagacgggactcactgtcttgat
attgatgaatgccaactggacacgcacacctgtggggaaaatgccacctgtacaaataca
gagggaaactacacctgcatgtgtgccggcagcctgtctgaacccggacaaatgtgccct
gactcaactgcactcgctcctctcagggaagagggccagtattctgtgagaaacagctac
ccagaatgccccccgtcccacgccggctactgtcttcacgacggagtgtgtatgtacatt
gaagccgtggacaactatgcatgcaactgtgtcgttggctacgttggagagcgatgtcag
caccgagacttgaaatggtgggaattgcgccatgctggccacgggcggcagtgggacatc
acagtggtggctgtctgcatggtggtgctcgtcctgctgctgcttctggggctgtggggc
actcactactacaggactaagaagctactatcaaaaaatccaaagaacccttatgaagag
tctaacagagaagtgagcattaccaggcctgcagacagagaggctgggatgtcctcctgc
ccccaaccttggtttgtggttataaaagaacatcagaacctcagtaatgggaaccaacct
gttaccctccaggatggccaggcagcaggagggggccagtttctctcccgagagcccggg
tcagtgcaaccgacatcatggaggaaggagccccaggtgtgtctgggcacagagcaaggc
tgctgcaattcaccacccagcgataatggctctggtccccagggagtggagagcagcttt
tctctcccctcctatgtggcgaggcccattgttgtgggggctgagaggccccgttctctc
ctgtcagctaacccattatggcaacaaagggcccgggattcaccataccaaatggaacag
aatcagtga

DBGET integrated database retrieval system