KEGG   Hipposideros armiger (great roundleaf bat): 109379590Help
Entry
109379590         CDS       T04661                                 

Definition
(RefSeq) glutathione S-transferase omega-2-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00480  Glutathione metabolism
hai00980  Metabolism of xenobiotics by cytochrome P450
hai00982  Drug metabolism - cytochrome P450
hai00983  Drug metabolism - other enzymes
hai01524  Platinum drug resistance
hai05200  Pathways in cancer
hai05204  Chemical carcinogenesis
hai05225  Hepatocellular carcinoma
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109379590
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109379590
   00982 Drug metabolism - cytochrome P450
    109379590
   00983 Drug metabolism - other enzymes
    109379590
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    109379590
   05204 Chemical carcinogenesis
    109379590
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    109379590
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    109379590
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    109379590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hai02000]
    109379590
Enzymes [BR:hai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109379590
Transporters [BR:hai02000]
 Other Transporters
  Pores ion channels [TC:1]
   109379590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 109379590
NCBI-ProteinID: XP_019491802
LinkDB All DBs
Position
Un
AA seq 244 aa AA seqDB search
MADEASRTLGKGSIFPGPVPEGLIRIYSMRFCPYAHRTRLVLRAKGIRHEVININLRNKP
EWYYTKHPFGQIPVLENSKCQLIYGSVIACEYLDDAYPGKKLCPYDPYERARQKMLLELF
YKIPRLTKECLVALKCGRDCTALKLSLRQEFCNFEEILDYQNTIFFGGDCISMIDYLFWP
WFERLDVYGIADCVNHTPALRLWIEAMKQDPAVCALLIDKNIFLGFLNLYFQNDPDAFDY
GLNC
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgaagcgagcaggaccttggggaaaggaagcatctttccagggccggttcca
gagggcctgatccgcatctacagcatgaggttctgcccttatgcacacaggacgcgcctc
gtcctccgggccaaaggcatcagacatgaagttatcaacattaacctgagaaacaagcct
gaatggtactatacaaagcacccttttggccaaattcctgtcctagaaaacagcaaatgt
caactgatctacggatctgtcatcgcttgtgagtacctggatgatgcttatcccggaaag
aagctgtgtccatatgacccttatgagcgagctcgacaaaagatgttactggaattattc
tataagatcccacgtttgaccaaggagtgtctggtagcattgaaatgtgggagagactgc
actgctttgaagctatcccttcgtcaggaattctgcaattttgaagagattcttgactat
cagaacaccatcttctttggtggagattgtatatccatgattgattacctcttttggccc
tggtttgagcggctggatgtgtatggaatagctgactgtgtgaaccacacgccagcactt
cggctctggatagaagccatgaagcaggaccccgcagtctgcgcgcttctcatcgataag
aacatttttctgggcttcttgaatctctattttcagaacgaccctgatgcctttgactat
ggactgaattgctga

DBGET integrated database retrieval system