KEGG   Hipposideros armiger (great roundleaf bat): 109379632
Entry
109379632         CDS       T04661                                 

Gene name
CHUK
Definition
(RefSeq) conserved helix-loop-helix ubiquitous kinase
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01523  Antifolate resistance
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04062  Chemokine signaling pathway
hai04064  NF-kappa B signaling pathway
hai04068  FoxO signaling pathway
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04380  Osteoclast differentiation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04625  C-type lectin receptor signaling pathway
hai04657  IL-17 signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04668  TNF signaling pathway
hai04920  Adipocytokine signaling pathway
hai05010  Alzheimer disease
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05212  Pancreatic cancer
hai05215  Prostate cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109379632 (CHUK)
   04014 Ras signaling pathway
    109379632 (CHUK)
   04064 NF-kappa B signaling pathway
    109379632 (CHUK)
   04668 TNF signaling pathway
    109379632 (CHUK)
   04068 FoxO signaling pathway
    109379632 (CHUK)
   04151 PI3K-Akt signaling pathway
    109379632 (CHUK)
   04150 mTOR signaling pathway
    109379632 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109379632 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109379632 (CHUK)
   04621 NOD-like receptor signaling pathway
    109379632 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    109379632 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    109379632 (CHUK)
   04625 C-type lectin receptor signaling pathway
    109379632 (CHUK)
   04660 T cell receptor signaling pathway
    109379632 (CHUK)
   04658 Th1 and Th2 cell differentiation
    109379632 (CHUK)
   04659 Th17 cell differentiation
    109379632 (CHUK)
   04657 IL-17 signaling pathway
    109379632 (CHUK)
   04662 B cell receptor signaling pathway
    109379632 (CHUK)
   04062 Chemokine signaling pathway
    109379632 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109379632 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109379632 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109379632 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109379632 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109379632 (CHUK)
   05221 Acute myeloid leukemia
    109379632 (CHUK)
   05220 Chronic myeloid leukemia
    109379632 (CHUK)
   05215 Prostate cancer
    109379632 (CHUK)
   05222 Small cell lung cancer
    109379632 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109379632 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109379632 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109379632 (CHUK)
   05135 Yersinia infection
    109379632 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109379632 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    109379632 (CHUK)
   05162 Measles
    109379632 (CHUK)
   05164 Influenza A
    109379632 (CHUK)
   05161 Hepatitis B
    109379632 (CHUK)
   05160 Hepatitis C
    109379632 (CHUK)
   05168 Herpes simplex virus 1 infection
    109379632 (CHUK)
   05163 Human cytomegalovirus infection
    109379632 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109379632 (CHUK)
   05169 Epstein-Barr virus infection
    109379632 (CHUK)
   05165 Human papillomavirus infection
    109379632 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109379632 (CHUK)
   05142 Chagas disease
    109379632 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109379632 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109379632 (CHUK)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     109379632 (CHUK)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109379632 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 109379632
NCBI-ProteinID: XP_019491865
LinkDB
Position
Un
AA seq 746 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHSNVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKTIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSLGTMVFECIAGYRPFLHHLQPFAWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQHRGGPVDPTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTASQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKVIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSSIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPPQASAWLPPTSAEREHPLSCVVTPQDGETLAHMIEENLNCLGH
LSTIIHKANEEQSSGMMNLDWSWLTE
NT seq 2241 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgagagcgg
ctgggcaccggcggcttcgggaacgtctgcctgtaccagcatcgggaacttgacctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagagcggtggtgtcat
gaaatccagatcatgaaaaagttgaaccactcaaatgttgtgaaggcctgtgatgttcct
gaggaattgaattttttgattaatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccggaagctactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactttctttactgagtgatatagggtctgggattcgatatttgcatgaaaacaaaatt
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttggtggaaagactata
cataaaataattgatctgggatatgccaaagacgttgatcaaggaagtctgtgtacgtct
tttgtgggaacattgcagtatctggccccagaactctttgagaataagccttacacagcc
actgttgattattggagcttgggaaccatggtgtttgaatgtattgctggctacaggcct
tttctgcatcatctgcagccatttgcctggcatgagaaaattaagaagaaggatcccaag
tgtatatttgcgtgtgaagagatgacaggagaagttcggtttagtagtcatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacaattgatgctg
aactgggatcctcagcatagaggaggacctgttgatcctactttgaagcagccaagatgt
tttgtattaatggatcacattctgaatttaaagatagtacacatcctaaatatgacttct
gcgaagataatttcttttctgttaccacctgatgaaagtcttcattcactgcagtctcgt
attgagcgtgaaactggaataaatactgcttctcaagagcttctttcagagacgggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagtaagaggctgtgat
agctatatggtttatttgtttgataaaagtaagactgtatatgaaggaccgtttgcttcc
agaagtttatctgactgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
atacagctgcgtaaagtgtgggctgaagcagtgcactatgtgtctgggctaaaagaagac
tacagcaggctctttcagggacagagagcagccatgttaagccttcttagatataatgct
aacttgacaaaaatgaagaacacgttgatctcagcatctcagcaactgaaagctaaactg
gagttttttcacaaaagcattcagcttgacttggaaagatatagtgaacagatgacttat
ggaatatcctcagaaaaaatgttaaaagcatggaaggaaatggaagaaaaggctatccat
tatgctgaggtgggtgtcattggatacctggaggatcagatcatgtccctgcacactgaa
atcatggagctacagaagagcccctatggaagacgtcagggagacttgatggaatctctg
gaacagcgcgccattgatctatacaagcagttaaagcatagaccgtcagatcactcctac
agcgacagcacagagatggtgaaggtcattgtgcatactgtgcagagccaggaccgggtt
ctcaaggagctgtttggtcatctcagcaagttgttgggctgtaagcagaagattattgat
ctactgcccaaggtggaaatggccctcagtagcatcaaagaagctgacaataccgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttcagcccggtcccttgtaggatccagtctagaaggtgcagtgactccccctcaggca
tcagcatggctgcccccaacttcagcagaacgtgaacatcctctgtcatgtgtggtaact
cctcaagatggggagactttggcacacatgatagaagaaaatttgaactgtcttggccat
ttaagcactattattcataaagcaaatgaggaacagagcagtggaatgatgaatcttgat
tggagttggttaacagaatga

KEGG   Hipposideros armiger (great roundleaf bat): 109386279
Entry
109386279         CDS       T04661                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01523  Antifolate resistance
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04062  Chemokine signaling pathway
hai04064  NF-kappa B signaling pathway
hai04068  FoxO signaling pathway
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04380  Osteoclast differentiation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04625  C-type lectin receptor signaling pathway
hai04657  IL-17 signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04668  TNF signaling pathway
hai04722  Neurotrophin signaling pathway
hai04910  Insulin signaling pathway
hai04920  Adipocytokine signaling pathway
hai04930  Type II diabetes mellitus
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai05010  Alzheimer disease
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05206  MicroRNAs in cancer
hai05212  Pancreatic cancer
hai05215  Prostate cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109386279 (IKBKB)
   04014 Ras signaling pathway
    109386279 (IKBKB)
   04064 NF-kappa B signaling pathway
    109386279 (IKBKB)
   04668 TNF signaling pathway
    109386279 (IKBKB)
   04068 FoxO signaling pathway
    109386279 (IKBKB)
   04151 PI3K-Akt signaling pathway
    109386279 (IKBKB)
   04150 mTOR signaling pathway
    109386279 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109386279 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109386279 (IKBKB)
   04621 NOD-like receptor signaling pathway
    109386279 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    109386279 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    109386279 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    109386279 (IKBKB)
   04660 T cell receptor signaling pathway
    109386279 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    109386279 (IKBKB)
   04659 Th17 cell differentiation
    109386279 (IKBKB)
   04657 IL-17 signaling pathway
    109386279 (IKBKB)
   04662 B cell receptor signaling pathway
    109386279 (IKBKB)
   04062 Chemokine signaling pathway
    109386279 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109386279 (IKBKB)
   04920 Adipocytokine signaling pathway
    109386279 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109386279 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109386279 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109386279 (IKBKB)
   05206 MicroRNAs in cancer
    109386279 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109386279 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109386279 (IKBKB)
   05221 Acute myeloid leukemia
    109386279 (IKBKB)
   05220 Chronic myeloid leukemia
    109386279 (IKBKB)
   05215 Prostate cancer
    109386279 (IKBKB)
   05222 Small cell lung cancer
    109386279 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109386279 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109386279 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109386279 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    109386279 (IKBKB)
   04931 Insulin resistance
    109386279 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109386279 (IKBKB)
   05135 Yersinia infection
    109386279 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109386279 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    109386279 (IKBKB)
   05162 Measles
    109386279 (IKBKB)
   05164 Influenza A
    109386279 (IKBKB)
   05161 Hepatitis B
    109386279 (IKBKB)
   05160 Hepatitis C
    109386279 (IKBKB)
   05168 Herpes simplex virus 1 infection
    109386279 (IKBKB)
   05163 Human cytomegalovirus infection
    109386279 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109386279 (IKBKB)
   05169 Epstein-Barr virus infection
    109386279 (IKBKB)
   05165 Human papillomavirus infection
    109386279 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109386279 (IKBKB)
   05142 Chagas disease
    109386279 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109386279 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109386279 (IKBKB)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     109386279 (IKBKB)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109386279 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr Pkinase_fungal IKKbetaNEMObind Kdo ubiquitin APH YrbL-PhoP_reg Med20 Glyco_hydro_65m GTSE1_N
Other DBs
NCBI-GeneID: 109386279
NCBI-ProteinID: XP_019504822
LinkDB
Position
Un
AA seq 771 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVFEDLNGAVKFSSSLPYPNNLNSVLAQRLEKWLQLMLMWHPRQRGTDPAYGPNGCF
KALDDILNLKLVHILNMVTGTIHNYPVTEDESLQSLKARIRQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDSKLNEGRTLDMDLVFLFDNSKIAYETQISPRPQPESVSCILQEPKRN
LSFFQLRKVWGQAWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGREDEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQA
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLTHSGQLMSQPPNAPNSLPESVNKSEELMAEAHTLWSQLE
SAMQDTMKEQDQSLQVMNGLCEPQLPHVLSTADEKKKMGRQSSVSSMLVHT
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccttgccaacccagacatgtggggcctgggaaatgaaagaaaga
cttggaacagggggatttggaaacgtcatccgatggcacaatcaggaaacaggtgagcag
attgctatcaagcagtgccggcaggagctcagtccccggaatcgagagcggtggtgcctg
gagatccagatcatgagaaggctgaaccaccccaacgtggtggctgcccgggatgtccct
gaggggatgcagaacttggctcccaatgacttgcccctgctggccatggagtactgccaa
ggaggagatctccgaaagtacctgaaccagttcgaaaactgctgtggcctgcgggaagga
gccatcctcaccttgctgagtgacattgcctctgcacttagataccttcatgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagagcaaagatta
atacacaaaattattgacctaggatatgccaaggaactggatcagggcagtctctgtact
tcctttgtggggaccctgcagtacctggctccggaactgctggagcagcagaagtacaca
gtgactgtggactactggagcttcggcaccttggctttcgagtgcatcacgggcttccgg
cctttcctccccaactggcagcctgtgcagtggcattccaaagtccggcagaagagtgag
atggacatcgttgtttttgaagacttgaatggagcagtgaagttttcgagctctttaccc
taccccaataatcttaacagcgtcctggcacagcggctggagaagtggctgcagctgatg
ctaatgtggcacccccgacaaaggggcactgatcctgcgtacgggcccaacggctgcttc
aaggccctggatgacatcttaaacttaaagctggttcatatcttgaacatggtcacaggc
accattcacaactacccggtgacagaggacgagagtctgcagagcttaaaggccagaatc
cggcaagacacaggaatccccgaggaggatcaggagctgctgcaagaagcggggctggcc
ttgatccccgacaagcctgccactcagtgtatttccgacagcaagctaaatgagggccgc
acactggacatggatctcgtttttctctttgacaacagcaaaattgcctatgagactcag
atctccccacggccccaacctgaaagtgtcagctgtatcctccaagagcccaagaggaac
ctgtctttcttccagctgaggaaagtgtggggccaagcctggcacagcatccaaaccctg
aaggaggactgtaaccggctgcagcagggacagcgagctgccatgatgaatctcctccgg
aataacagctgcctctccaagatgaagaattccatggcttccatgtcacagcagctcaag
gccaagttggatttctttaagaccagcatccagattgacctggagaagtatagtgaacaa
accgagtttgggatcacatcagataaactgctgctggcctggagggaaatggaacaggct
gtggagctctgtgggcgggaggatgaagtgaagcatctagtggaacggatgatggcgctg
cagacggacatcgtggacttgcagaggagcccgatgggccggaagcagggggggactctg
gatgacctagaagagcaagcaagggagctttacaggagactaagggaaaaaccaagagac
caacgaactgagggtgacagtcaggaaatggtgcggctgctacttcaggcaatccaagcc
tttgagaagaaagtgcgagtgatctacacgcagctcagtaaaactgtggtttgcaagcag
aaggctctggaattgttgcccaaggtggaagaggtagtgagtttaatgaatgaggatgag
aagacagttgttcgtcttcaggagaagcgacaaaaggaactgtggaatctcctgaagatc
gcttgtagtaaggtccgtggtcctgtcagtggaagcccagatagcatgaatgcttctcgc
cttactcactctggtcagctgatgtctcagcctcctaacgcacccaacagcttacctgag
tcagtcaacaaaagtgaagaactgatggctgaagcacatactctctggagccaactagaa
agtgcaatgcaagacaccatgaaagaacaggaccagagtttacaggtaatgaatggcctg
tgtgaaccccagctaccccacgtcctttctacagcagatgagaaaaagaaaatgggaagg
caatccagtgtttcctcaatgttagtacacacttag

DBGET integrated database retrieval system