KEGG   Hipposideros armiger (great roundleaf bat): 109379737
Entry
109379737         CDS       T04661                                 

Gene name
TRIM25
Definition
(RefSeq) tripartite motif containing 25
  KO
K10652  tripartite motif-containing protein 25 [EC:2.3.2.27]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04064  NF-kappa B signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109379737 (TRIM25)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109379737 (TRIM25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109379737 (TRIM25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hai04121]
    109379737 (TRIM25)
Enzymes [BR:hai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109379737 (TRIM25)
Ubiquitin system [BR:hai04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    109379737 (TRIM25)
SSDB
Motif
Pfam: PRY SPRY zf-C3HC4_4 zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-RING_2 zf-RING_5 zf-C3HC4_2 zf-B_box C5HCH zf-RING_4 Prok-RING_4 U-box Golgin_A5 zf-RING_11 zf-ANAPC11
Other DBs
NCBI-GeneID: 109379737
NCBI-ProteinID: XP_019492147
LinkDB
Position
Un
AA seq 580 aa
MAELSLADELTCSICLEPFKMPVTTPCGHNFCGSCLKETWAVPGAQYLCPQCRTAYQERP
QLRKNTVLCAVVDQFLQAELAREAAADGWTPPARAAAPSPADQVACDHCLKAAAVKTCLV
CMASFCQEHLQPHLDSPAFRDHPLQPPVHDLLRRKCPQHNRLREFFCPEHSECICHICLV
EHKTCSPVSLSQAGADLEAELKHKMTIMYSQINGASRALEDVRTKQQEVREAAQRKMEQL
RQDYLEMKSLIEASEVNAIRKIKDEEKRVSSKFDTIYQILLKKKSEIQTVKEETELALTK
GDEFEFLEPFFFGTGDPAEHGTAPTHKPRPLKKVPKEEKKPKKPGAASPSKTPTFGAPEQ
LVDLKQASLETSAKATTLQPNSTSLKAKVLENFLAKSRSELLEYSVKVILDYNTANNKVA
LSENYTVASVAETPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGIGICYG
SMDRQGPESRLGRNSASWCVEWFNTKISVWHNNVEKTLPSTKATRVGVLLSCDHGFVIFF
AVAGDKVHLMYKFKEDFTEALYPALWVFSAGATISICSFK
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggcggagctgtccctggccgacgagctgacgtgctccatctgcttggagcccttcaag
atgccggtcaccactccttgcggccacaacttctgcgggtcgtgcctgaaggagacgtgg
gccgtcccgggcgcgcagtacctgtgtcctcagtgccgtaccgcgtaccaggagcggccg
cagctccgcaagaacaccgtgctgtgcgccgtggtggatcagttcctgcaggccgagctg
gcccgcgaagcggccgccgacggctggacgccacccgctcgcgccgcggcccccagcccc
gccgaccaggtggcctgcgaccactgcctgaaggcggccgccgtcaagacatgcctcgtg
tgcatggcctccttctgccaggagcacctgcagccgcacctggacagccccgccttccgg
gaccacccgctgcagccgccggttcacgacctgttgcgccgcaagtgccctcagcacaac
cgactccgggaattcttctgccctgagcacagcgaatgcatttgccatatctgcctggtg
gagcacaagacctgctcgcctgtatccctgagccaggcaggcgctgacctggaggccgag
ctaaagcataagatgaccatcatgtacagtcagatcaacggtgcatcgagagcgctggaa
gatgtgagaaccaagcagcaggaagtgcgggaggctgcacaaagaaagatggagcagctc
agacaagactacttggaaatgaagtctctcattgaagcttcagaggtcaacgccatacga
aagataaaggacgaggagaagagggtcagcagcaagtttgacaccatttaccagatcctt
ctcaagaagaagagtgagatccagactgtgaaggaggagactgaacttgccctgactaaa
ggggatgagtttgagtttctggagcccttcttctttggcacaggggaccctgcagagcat
ggcacggcacccacacacaaaccacgccctttgaagaaggtcccgaaagaagaaaagaaa
cccaagaaacctggtgctgcctcacccagcaagactcccacctttggagccccggaacag
ttggtggacttaaaacaagctagcttggagacttcagccaaagccaccaccttgcagccg
aactcaacatctctcaaggccaaggtgctggagaacttcttagccaagtccagatctgag
ctcctggaatattctgtgaaagtcatcctagactacaacaccgccaacaacaaggtggct
ctgtcggagaactacactgtagcatctgtggctgagacaccccagaattaccggccacat
ccccagaggttcacatactgttctcaggtgctaggcctgcactgctacaaaaaagggatc
cactactgggaggtggagctgcagaagaacaacttctgtgggatcggcatctgctatggc
agcatggatcgccagggccccgagagccggctgggccgcaatagtgcctcctggtgtgtg
gagtggttcaacaccaaaatctctgtctggcacaacaatgtggagaaaaccctgccttcc
accaaggccacgcgggttggtgtgcttctcagttgcgaccacggctttgtcattttcttt
gctgtcgctggtgacaaggtccacctgatgtataagttcaaggaggactttaccgaggct
ctgtacccggccctctgggtgttctcagcaggtgccaccatctctatctgctcctttaag
tag

DBGET integrated database retrieval system