KEGG   Hipposideros armiger (great roundleaf bat): 109379834
Entry
109379834         CDS       T04661                                 

Gene name
IFIH1
Definition
(RefSeq) interferon induced with helicase C domain 1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04622  RIG-I-like receptor signaling pathway
hai05161  Hepatitis B
hai05162  Measles
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109379834 (IFIH1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109379834 (IFIH1)
   05164 Influenza A
    109379834 (IFIH1)
   05161 Hepatitis B
    109379834 (IFIH1)
   05168 Herpes simplex virus 1 infection
    109379834 (IFIH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hai04054]
    109379834 (IFIH1)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109379834 (IFIH1)
Pattern recognition receptors [BR:hai04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   109379834 (IFIH1)
SSDB
Motif
Pfam: RIG-I_C CARD_2 RIG-I_C-RD Helicase_C ResIII DEAD CARD SWI2_SNF2 DUF3638 AAA_22 AAA_19
Other DBs
NCBI-GeneID: 109379834
NCBI-ProteinID: XP_019492350
LinkDB
Position
Un
AA seq 1025 aa
MSNGHSADKSFRYLISCFRARVKRYIQVEPVLDYLDFLPADVKEKIERTALTNGNIQAAE
LLLSTLEKGVWPLGWTRVFVEALRRAGSPLAARYMNPELTDLPSPSYENTHDECLQLLSL
LQPTLVDKLLVRDVLDKGVELDLLTIEDRNRISAAENNGNEAGVRELLKRIVQKENWFST
FLTVLRETENDALVQELTGTSASESNAETENLYQDNGPEVNEPLPLATDQPSPEKQGLDM
ENTSLESSFGDSSIASESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEEKVAERA
SPEPELHIRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYITKDHLDKKKKASKPGKVI
VLVNKVPLVEQLFRKEFLPFLKKWYCVIGLSGDTQLKISFPNVVKTHDVIISTAQILENS
LLNSEKGEDAGVELSDFSLIVIDECHHTNKEAVYNNIMRRYLKQKLKNKRLEKEHKPVIP
LPQIIGLTASPGVGGANKQAKAEEHILKICAHLDASTITTVKENIGQLKDQIKEPCKKFE
IADNTRKDPFKDKLLEIMTKIQTFCQMSPMHDFGTQPYEQWAIQMEKKAAREGNRKERLC
AEHLRKYNEALQINDTIRMIDAYNHLETFYNDEKEKKFAVLDDDSDDSSDDGGNGDDDED
DGKKPLKLDETDSFLMTLFLENKKMLKKLAENPEHENEKLTKLRNTIMEQYTRTAESARG
IIFTKTRQSAYALSQWIAENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTG
KINLLIATTVAEEGLDIKECNIIIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGVV
ERETVNDFREKMMYKAINRVQNMDPQEYAHKISELQLQSIMEKKMKIKKSIAKHCKENPA
LINFICKNCSVLACSGDYIHVIEKMHHVNMTPEFKELYLVRENKALQKKFADYQTNGEII
CKTCGQAWGTMMVHKGLDLPCLKIKNFVVVFKKNSMKKQYKKWVELPITFPDLDYAEYCW
CSDED
NT seq 3078 nt   +upstreamnt  +downstreamnt
atgtcgaatgggcattccgcagacaagagttttcgctatctcatctcatgcttccgggcc
agagtgaaaaggtacatccaggtggagcctgtgctggactacctggactttctgcctgca
gacgtgaaggagaagattgagaggacagccctcaccaatgggaacattcaggcagctgaa
ctgctcctgagcaccttggagaagggggtctggcccctgggctggactagggtatttgtg
gaggccctccggcgagcagggagccctttagccgcccgctacatgaatcctgagctcaca
gacttgccctctccatcctatgagaacacgcatgatgagtgtctccaactgctgagcctt
ctacagcccaccctggtggacaagctgctcgttagagatgtcctggataaaggtgtggag
ctggatctgttgacaattgaagatagaaatcggatttctgctgcagaaaacaatggaaat
gaagctggtgtgagagagctcctgaaaaggatcgtgcagaaagaaaactggttttctacc
tttctgactgttctgagggaaacggaaaacgatgcgcttgtccaagaattaacaggcacc
agtgcctctgaaagcaatgcagaaactgagaatttataccaagacaatggtcctgaagtt
aacgagccacttcctttagcaacagatcagccaagtccagagaaacagggcttggacatg
gagaatacttcactggaatcatcttttggggattcttctatagcttcagaatcagacaca
agtttggcagaaggaagtgtcagctgcttagatgaaagtcttggacataacagcaacatg
ggcagtgattcaggcaccatgggaagtgattcagatgaagagaaagtggcagaaagagca
tcccctgagccagagctgcatatcaggccttaccaaatggaagttgcccaaccagccttg
gagggaaagaatatcattatatgcctccctaccgggagtgggaaaaccagagtggccgtt
tacatcaccaaggatcacttagacaagaagaaaaaagcatccaaaccgggaaaagttata
gtccttgtcaataaggtaccattagttgaacagctcttccgcaaagagtttctaccattt
ttgaagaaatggtattgcgttattggactaagtggtgatacccaattgaaaatatcattt
ccaaatgttgtcaaaacccatgatgttattatcagtacagctcaaatccttgaaaactcc
cttttaaactcagaaaaaggagaagatgctggtgtcgagttgtcagacttttccctcatc
gtcattgatgaatgccatcacaccaataaagaagcagtctataataacatcatgaggcgt
tatttgaaacaaaagttgaaaaacaagaggctcgagaaagaacacaagccagtgattcca
ctacctcagataataggactaacagcttcaccaggtgttggaggagccaacaagcaagcc
aaagccgaagaacacattttaaaaatatgtgcccatcttgatgcatctactattacaact
gtgaaagaaaacattggtcaactcaaagaccaaataaaggagccatgcaaaaagtttgaa
attgcagataacaccagaaaagatccatttaaagataagcttctggaaataatgacaaag
attcaaactttttgccaaatgagtccaatgcacgattttggaactcaaccctatgaacaa
tgggccattcaaatggaaaaaaaagctgcaagagaagggaatcgcaaagaacgtctttgt
gcagaacatttgaggaagtacaatgaggccctacaaattaatgacacaatccgaatgatt
gatgcatataatcaccttgaaactttctataatgatgaaaaagaaaagaagtttgcagtc
ctagatgatgatagcgatgacagcagtgacgatggtggtaatggtgatgacgatgaggat
gatggaaagaaacctttgaaattggatgagacagatagttttctcatgactttatttttg
gaaaacaagaaaatgttgaaaaagctggctgagaacccagaacatgaaaatgaaaagctg
accaaattaagaaacacaataatggaacaatacacaagaacggcggaatcagcaagagga
ataattttcacaaaaacacgacagagtgcatatgctctttctcagtggattgctgaaaat
gaaaaatttgcagaagtaggagtcaaagcccaccatctgattggagctggacacagcagt
gaattcaagcccatgacacagaatgaacaaaaagaagtcattagtaaatttcgcacagga
aaaataaatctgcttattgctaccacagtggcagaagaaggtctggatattaaagaatgt
aatatcattattcgttatggtctcgtcactaatgaaatagccatggtccaggcccgcggt
cgagccagagccgatgagagcacttacgtcctggttgcccacagcggctcaggagttgtt
gaacgtgagacagttaatgatttccgagagaaaatgatgtataaagctataaaccgtgtt
caaaatatggatccacaggagtatgctcataagatttcagaattacagttacaaagtata
atggaaaagaaaatgaaaatcaagaaaagcatcgcaaagcattgcaaggaaaacccagca
ttaataaattttatctgcaaaaattgcagtgtgctcgcctgctctggagactatatccat
gtaattgagaagatgcaccatgtcaacatgacaccagaattcaaggaactctaccttgtg
agagaaaacaaagccctgcaaaagaagtttgcagactatcaaacaaatggtgagattatc
tgcaaaacttgtggccaggcttggggaacaatgatggtgcacaaaggcttagatttgcct
tgtctcaaaataaaaaattttgtagtggttttcaaaaagaactcaatgaagaaacaatac
aaaaagtgggtagaattacctatcacatttcctgatcttgactatgcagaatattgttgg
tgtagtgatgaagattaa

DBGET integrated database retrieval system