KEGG   Hipposideros armiger (great roundleaf bat): 109379978Help
Entry
109379978         CDS       T04661                                 

Gene name
PIGT
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    109379978 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 109379978
NCBI-ProteinID: XP_019492633
LinkDB All DBs
Position
Un
AA seq 602 aa AA seqDB search
MRSSYWRPASGGGGRRWEAEAAAGMAAAVPLAVLVLLLLGPGGWGHAEPLRDSLREELVI
TPLPSGDVAATFQFRTRWDSDLLQEEVSHYRLFPKALGQLISKYSLRELHLSLTQGFWRT
RYWGPPFLQAPSGAELWVWFQDTVTDVDKSWKELSNVLSGIFCASLNFIDSTNTVTPTAS
FKPLGLANDTDHYFLRYAVLPREVVCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYH
SQAVHIRPVCRNARCTSVSWELRQTLSVVFDAFVTGQGKKDWSLFRMFSRTLTEPCPLAS
ESRVYVDITSYSQDNETLEVNPPPLTTYQDVILGTRKTYAVYDLLDMAVISSSRNLNIQL
KWKRPLENEVPPVPFLHAQRYVSGYGLQNGELSTLLYNTHPYRAFPVLLLDTVPWYLRLY
VHTLTITSKGKENKPSYIHYQPAQDRLQPHLLEMLVQLPANSVTKVSIQFERALLKWTEY
TPDPNHGFYVSPSVISALVPSMVAAKPVDWEESPLFSNLFPASDSSSYFMRLYTEPLLVS
LPTPDFSMPYNVICLTCTVVAVCYGSFYNLLTRTFHIEEPSTGGLAKRLANLIRRARGVP
PL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcttcctattggaggccggcctctggtgggggcgggcgccgttgggaggcggaa
gcagccgcaggcatggcagcggctgtgccgctagcggtgctcgtgctgctgcttctgggg
ccgggcggctggggccatgcagagcccctacgcgacagcctgagagaggagctcgtcatc
accccgctgccttctggagatgtagccgccacattccagttccgtacacgctgggattcg
gacctcctgcaggaagaagtgtctcattataggctcttccccaaagccctggggcagttg
atctccaagtattctctccgggagctgcacctgtcactcacgcaaggcttctggaggact
agatactgggggccacccttcctgcaggccccatcaggtgcagagctctgggtctggttc
caagacaccgtcactgatgtggataaatcttggaaagagctcagtaacgtcctctcaggc
atcttctgcgcctctctcaacttcatcgactccaccaacacagtcacccccaccgcctcc
ttcaaacccctggggctggccaatgacactgatcactatttcctgcgctatgctgtgctg
ccacgggaggtcgtctgcactgagaacctcacgccctggaaaaagctcttgccttgtagc
tccaaggcaggcctctctgtgctgctgaaggctgatcgcttgttccacactagctaccac
tcgcaggcagtgcatatccgccccgtttgcagaaacgcacgctgtaccagcgtctcctgg
gagctgaggcagaccctttctgttgtatttgatgccttcgtcacagggcaggggaagaaa
gactggtccctcttccggatgttctcgcgaaccctcacagagccctgccccctggcttcg
gagagccgagtctatgtggacatcaccagctacagtcaggacaatgagacattggaagtg
aatccgcccccgctcaccacataccaggacgtcatcctgggcacccggaagacctacgct
gtctacgacttgcttgacatggctgtcatcagcagctcccgcaacctcaatatccaactc
aagtggaagagacccctcgagaatgaggtccccccggtgcccttcctgcatgcccagcga
tatgtgagcggctacgggctgcagaacggggagctgagcacgctgctgtacaacacccac
ccgtaccgggccttccctgtgctgctgctggacaccgtgccctggtacctgcggctgtat
gtgcacacgctcaccatcacctccaagggcaaggagaacaaaccaagttacatccactac
cagcctgcccaggaccggctgcagccccacctcctggagatgctggtccagctgccagcc
aactcggtcaccaaggtctccatccagtttgagcgggcgctgctcaagtggacagagtac
accccggaccccaaccacggcttctatgtcagcccgtctgtgatcagcgccctcgtgccc
agcatggtggcagctaaacctgtggactgggaagagagccccctcttcagcaacctgttc
ccagcctccgatagttctagctacttcatgcggctctatacggagccgctgctggtgagc
ctgccgacgccagacttcagcatgccctacaatgtcatctgcctcacgtgcaccgtggtg
gccgtgtgctatggctccttctacaacctcctcacccgaaccttccacatcgaggagccc
agcaccggtggcctggccaagaggctggcgaaccttatccggcgcgcccgtggagtgccc
ccgctctga

DBGET integrated database retrieval system