KEGG   Hipposideros armiger (great roundleaf bat): 109380123
Entry
109380123         CDS       T04661                                 

Gene name
RAE1
Definition
(RefSeq) ribonucleic acid export 1
  KO
K14298  mRNA export factor
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03013  RNA transport
hai05014  Amyotrophic lateral sclerosis
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109380123 (RAE1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109380123 (RAE1)
  09172 Infectious disease: viral
   05164 Influenza A
    109380123 (RAE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109380123 (RAE1)
   03036 Chromosome and associated proteins [BR:hai03036]
    109380123 (RAE1)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     109380123 (RAE1)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109380123 (RAE1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 Exonuc_X-T_C
Other DBs
NCBI-GeneID: 109380123
NCBI-ProteinID: XP_019492934
LinkDB
Position
Un
AA seq 377 aa
MHSLPPRVKMSLFGTTSGFGTGGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPT
LPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAK
MWDLNSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPE
RCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGF
ALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATV
GSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKN
YIFLRNAAEELKPRNKK
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgcactcgcttccccccagggtcaaaatgagtctgtttggaacaacctcgggttttgga
actggtgggaccagcatgtttggcagcacaaccacagataaccacaacccgatgaaggat
attgaagtaacatcctctcctgacgacagcattggttgtctatcttttagcccaccaacc
ttgccggggaactttcttattgcaggatcgtgggctaacgacgttcgctgctgggaagtt
caggatagtgggcagactataccaaaagcccaacagatgcacaccgggcccgtgctagac
gtgtgctggagtgatgatgggagcaaagtatttacggcttcttgtgataaaactgccaaa
atgtgggatctcaacagtaaccaagcaatacagattgcacagcacgatgctcctgttaaa
accatacattggatcaaagcaccaaactacagctgtgtgatgaccgggagctgggataag
actttgaagttttgggatacgcgatcatcaaatcctatgatggttttgcagctccctgaa
aggtgttactgtgctgacgtgatataccctatggccgtggtggcaactgcggagagggga
ctgattgtctatcaattagagaaccagccttctgaattcaggaggatagaatctccactg
aaacatcagcatcgatgtgtggctatttttaaagacaaacagaacaagccgactggtttt
gccttgggaagcatcgaggggagagttgctattcactacatcaaccccccaaaccctgcc
aaggataactttaccttcaaatgtcaccgatctaacggaaccaacacttcagcccctcag
gacatctacgcggtgaatggaatcgcattccatcccgttcatggcacccttgcaactgtg
ggatctgatggtagattcagcttttgggacaaagatgccagaacaaaactaaaaacttca
gaacagttagatcagccgatctcagcttgctgcttcaatcacaatggaaacatctttgcg
tatgcttccagctacgactggtccaagggacatgaattctataatccccaaaagaaaaat
tacattttcctgcgtaacgcagctgaagagctaaaacccaggaataagaagtag

DBGET integrated database retrieval system