KEGG   Hipposideros armiger (great roundleaf bat): 109380137
Entry
109380137         CDS       T04661                                 

Gene name
PDGFA
Definition
(RefSeq) platelet derived growth factor subunit A
  KO
K04359  platelet-derived growth factor subunit A
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04072  Phospholipase D signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04510  Focal adhesion
hai04540  Gap junction
hai04630  JAK-STAT signaling pathway
hai04810  Regulation of actin cytoskeleton
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05206  MicroRNAs in cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05231  Choline metabolism in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109380137 (PDGFA)
   04014 Ras signaling pathway
    109380137 (PDGFA)
   04015 Rap1 signaling pathway
    109380137 (PDGFA)
   04630 JAK-STAT signaling pathway
    109380137 (PDGFA)
   04020 Calcium signaling pathway
    109380137 (PDGFA)
   04072 Phospholipase D signaling pathway
    109380137 (PDGFA)
   04151 PI3K-Akt signaling pathway
    109380137 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109380137 (PDGFA)
   04540 Gap junction
    109380137 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109380137 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109380137 (PDGFA)
   05202 Transcriptional misregulation in cancer
    109380137 (PDGFA)
   05206 MicroRNAs in cancer
    109380137 (PDGFA)
   05231 Choline metabolism in cancer
    109380137 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    109380137 (PDGFA)
   05218 Melanoma
    109380137 (PDGFA)
   05215 Prostate cancer
    109380137 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109380137 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109380137 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109380137 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109380137 (PDGFA)
Cytokines and growth factors [BR:hai04052]
 Growth factors
  Growth factors (RTK binding)
   109380137 (PDGFA)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109380137 (PDGFA)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 109380137
NCBI-ProteinID: XP_019492959
LinkDB
Position
Un
AA seq 241 aa
MNEKASVPPDRPRLRLSTPIVWGPQRFWQLGVSLPLHTWTLPVWEWRGSQRTPSVLRSEG
GLSCRKCCGQALGPSWSLSLLSVGAEDALESSLRAHSGRATKRTPQKPPLPIRRKRSIEE
AVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSV
KVAKVEYVRKKPKLKEVQVRLEEHLECTCTTASLNPDYREEETGRRRESGKKRKRKRLKP
T
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaacgagaaggcgtccgtccccccggaccgaccgaggctgcgcttgtcgacccccatc
gtgtgggggcctcagaggttttggcagctgggagtctccctccccctgcacacctggaca
ctccctgtgtgggagtggaggggctcccaaaggaccccgtccgtcttgaggagtgagggt
gggctgagctgcaggaagtgctgtggacaggccctggggcccagctggtcactgtccctt
ctttctgtaggggctgaggatgctctggaaagcagcctgagagcccacagcggccgtgcc
accaagcgcacgcctcagaagccacctctgcccattcggaggaagagaagcatcgaggaa
gctgtccctgccgtctgcaagaccaggacggtcatttatgagatacctcggagccaggtg
gaccccacgtctgccaactttctgatctggcctccctgtgtggaggtcaagcgctgcacg
ggctgctgtaacaccagcagcgtcaagtgccagccctcccgcgtgcatcaccggagtgtc
aaggtggccaaggtagagtacgtcaggaagaagccaaagttaaaagaagtgcaggtgagg
ctggaggagcacctggagtgcacgtgcacgaccgccagcctgaatcctgactaccgggag
gaggagacggggaggcgtagggagtcaggtaaaaagcggaaaagaaaaaggttaaaaccc
acctaa

KEGG   Hipposideros armiger (great roundleaf bat): 109392273
Entry
109392273         CDS       T04661                                 

Gene name
PDGFB
Definition
(RefSeq) platelet derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04072  Phospholipase D signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04510  Focal adhesion
hai04540  Gap junction
hai04630  JAK-STAT signaling pathway
hai04810  Regulation of actin cytoskeleton
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05200  Pathways in cancer
hai05206  MicroRNAs in cancer
hai05211  Renal cell carcinoma
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05231  Choline metabolism in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109392273 (PDGFB)
   04014 Ras signaling pathway
    109392273 (PDGFB)
   04015 Rap1 signaling pathway
    109392273 (PDGFB)
   04630 JAK-STAT signaling pathway
    109392273 (PDGFB)
   04020 Calcium signaling pathway
    109392273 (PDGFB)
   04072 Phospholipase D signaling pathway
    109392273 (PDGFB)
   04151 PI3K-Akt signaling pathway
    109392273 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109392273 (PDGFB)
   04540 Gap junction
    109392273 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109392273 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109392273 (PDGFB)
   05206 MicroRNAs in cancer
    109392273 (PDGFB)
   05231 Choline metabolism in cancer
    109392273 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    109392273 (PDGFB)
   05218 Melanoma
    109392273 (PDGFB)
   05211 Renal cell carcinoma
    109392273 (PDGFB)
   05215 Prostate cancer
    109392273 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109392273 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109392273 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109392273 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109392273 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109392273 (PDGFB)
Cytokines and growth factors [BR:hai04052]
 Growth factors
  Growth factors (RTK binding)
   109392273 (PDGFB)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109392273 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 109392273
NCBI-ProteinID: XP_019516155
LinkDB
Position
Un
AA seq 278 aa
MLAPARDPPSPRPPPWPRGRRARSTRPGPRGAGPGVGMNRCWALFLSLCCYLRLVSAEGD
PIPEELYEMLSDHSIRSFDDLQRLLHGDSVDEDGAELDLNLTQSHSGGKLESLSRGRRSL
DSPVAAEPAMIAECKTRTEVFEISRRLVDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRP
TQVQLRHVQVRKIEIVRKKPSFKKATVTLEDHLACKCETVVAARPVTRNPGTSQEQRART
LQTRVTIRTVRVRRPPKGKHRKFKHTHDKKALKETLGA
NT seq 837 nt   +upstreamnt  +downstreamnt
atgctcgctccggctcgggatccgcccagcccccgccctccaccctggccgcgggggcgg
cgcgctcggtccacgcgtccggggccccgcggggccgggcccggagtcggcatgaatcgc
tgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgccgagggggac
cccattcccgaggagctctacgagatgctgagtgaccactcgatccgctcctttgatgac
ctccagcgcctgctgcacggagactccgtagatgaagacggggctgagttggacctgaat
ttgacccagtcccattccggaggcaagctggagagcttatcccgagggagaaggagctta
gattccccagtggccgccgagccagccatgatcgcagagtgtaagacacgcaccgaggtg
tttgagatctcccggcgcctcgttgaccgcaccaacgccaacttcctggtgtggccgccc
tgtgtggaggtgcagcgctgctccggctgctgcaacaatcgcaacgtgcagtgccgcccc
acccaggtgcagctacgacacgtccaggtgagaaagattgagattgtgcggaagaagcca
agctttaagaaggccacagtgaccctggaggaccacctggcatgcaagtgtgagacggta
gtggctgcacgacctgtgaccagaaacccggggacttcccaggagcagcgagccaggaca
ctgcaaacgcgggtgaccattcggactgtgcgagtccgccggccccccaaggggaagcac
aggaaattcaagcacacgcatgacaagaaggcactgaaggagacccttggagcctag

DBGET integrated database retrieval system