KEGG   Hipposideros armiger (great roundleaf bat): 109380220
Entry
109380220         CDS       T04661                                 

Gene name
ACTB
Definition
(RefSeq) actin beta
  KO
K05692  actin beta/gamma 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04015  Rap1 signaling pathway
hai04145  Phagosome
hai04210  Apoptosis
hai04390  Hippo signaling pathway
hai04510  Focal adhesion
hai04520  Adherens junction
hai04530  Tight junction
hai04611  Platelet activation
hai04670  Leukocyte transendothelial migration
hai04714  Thermogenesis
hai04810  Regulation of actin cytoskeleton
hai04919  Thyroid hormone signaling pathway
hai04921  Oxytocin signaling pathway
hai04971  Gastric acid secretion
hai05014  Amyotrophic lateral sclerosis
hai05100  Bacterial invasion of epithelial cells
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05164  Influenza A
hai05205  Proteoglycans in cancer
hai05225  Hepatocellular carcinoma
hai05410  Hypertrophic cardiomyopathy
hai05412  Arrhythmogenic right ventricular cardiomyopathy
hai05414  Dilated cardiomyopathy
hai05416  Viral myocarditis
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109380220 (ACTB)
   04390 Hippo signaling pathway
    109380220 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109380220 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    109380220 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109380220 (ACTB)
   04520 Adherens junction
    109380220 (ACTB)
   04530 Tight junction
    109380220 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109380220 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109380220 (ACTB)
   04670 Leukocyte transendothelial migration
    109380220 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109380220 (ACTB)
   04919 Thyroid hormone signaling pathway
    109380220 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    109380220 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    109380220 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109380220 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109380220 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109380220 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109380220 (ACTB)
   05410 Hypertrophic cardiomyopathy
    109380220 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109380220 (ACTB)
   05414 Dilated cardiomyopathy
    109380220 (ACTB)
   05416 Viral myocarditis
    109380220 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109380220 (ACTB)
   05135 Yersinia infection
    109380220 (ACTB)
   05100 Bacterial invasion of epithelial cells
    109380220 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    109380220 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hai03021]
    109380220 (ACTB)
   03019 Messenger RNA biogenesis [BR:hai03019]
    109380220 (ACTB)
   03036 Chromosome and associated proteins [BR:hai03036]
    109380220 (ACTB)
   03029 Mitochondrial biogenesis [BR:hai03029]
    109380220 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hai04812]
    109380220 (ACTB)
   04147 Exosome [BR:hai04147]
    109380220 (ACTB)
Transcription machinery [BR:hai03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     109380220 (ACTB)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     109380220 (ACTB)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     109380220 (ACTB)
    NuA4 complex
     109380220 (ACTB)
  Chromatin remodeling factors
   BAF complex
    109380220 (ACTB)
   PBAF complex
    109380220 (ACTB)
   SWR1 complex
    109380220 (ACTB)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    109380220 (ACTB)
Cytoskeleton proteins [BR:hai04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     109380220 (ACTB)
Exosome [BR:hai04147]
 Exosomal proteins
  Proteins found in most exosomes
   109380220 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 109380220
NCBI-ProteinID: XP_019493102
LinkDB
Position
Un
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgacgatatcgctgcgctcgtggtcgacaatggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgccccccgggctgtcttcccctccatcgtggggcgcccccggcac
cagggcgtcatggtgggcatgggccagaaggactcctacgtgggcgacgaggcccagagc
aagagaggcatcctgaccctgaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaatgaactgcgtgtggcccctgaggag
caccctgtgctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgacc
cagatcatgttcgagaccttcaacaccccagccatgtacgtggccatccaggccgtgctg
tccctgtatgcctctggccgcaccactggcattgtgatggactccggtgacggggtcacc
cacactgtgcccatctacgaggggtacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgacggactacctcatgaagatcctcacggagcgtggctacagcttc
accaccacggccgagcgggaaattgtgcgtgacatcaaggagaagctctgctatgtcgcc
ctggacttcgagcaggagatggccaccgcggcctccagctcttctctggagaagagctac
gagctgcccgacgggcaggtcatcaccatcggcaacgagcggttccgctgccccgaggcg
ctcttccagccctccttcctgggcatggaatcctgtggcatccacgaaactaccttcaac
tcaatcatgaagtgtgacgtcgacatccgcaaggacctctacgccaacacggtgctgtct
ggtgggaccaccatgtacccaggcattgctgacaggatgcagaaggagatcaccgccctg
gctcccagcacaatgaagatcaagatcattgcgccccctgagcgcaagtactccgtgtgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtccggcccctccatcgtccaccgcaaatgcttctag

KEGG   Hipposideros armiger (great roundleaf bat): 109393048
Entry
109393048         CDS       T04661                                 

Gene name
ACTG1
Definition
(RefSeq) actin gamma 1
  KO
K05692  actin beta/gamma 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04015  Rap1 signaling pathway
hai04145  Phagosome
hai04210  Apoptosis
hai04390  Hippo signaling pathway
hai04510  Focal adhesion
hai04520  Adherens junction
hai04530  Tight junction
hai04611  Platelet activation
hai04670  Leukocyte transendothelial migration
hai04714  Thermogenesis
hai04810  Regulation of actin cytoskeleton
hai04919  Thyroid hormone signaling pathway
hai04921  Oxytocin signaling pathway
hai04971  Gastric acid secretion
hai05014  Amyotrophic lateral sclerosis
hai05100  Bacterial invasion of epithelial cells
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05164  Influenza A
hai05205  Proteoglycans in cancer
hai05225  Hepatocellular carcinoma
hai05410  Hypertrophic cardiomyopathy
hai05412  Arrhythmogenic right ventricular cardiomyopathy
hai05414  Dilated cardiomyopathy
hai05416  Viral myocarditis
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109393048 (ACTG1)
   04390 Hippo signaling pathway
    109393048 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109393048 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    109393048 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109393048 (ACTG1)
   04520 Adherens junction
    109393048 (ACTG1)
   04530 Tight junction
    109393048 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109393048 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109393048 (ACTG1)
   04670 Leukocyte transendothelial migration
    109393048 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109393048 (ACTG1)
   04919 Thyroid hormone signaling pathway
    109393048 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    109393048 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    109393048 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109393048 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109393048 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109393048 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109393048 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    109393048 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109393048 (ACTG1)
   05414 Dilated cardiomyopathy
    109393048 (ACTG1)
   05416 Viral myocarditis
    109393048 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109393048 (ACTG1)
   05135 Yersinia infection
    109393048 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    109393048 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    109393048 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hai03021]
    109393048 (ACTG1)
   03019 Messenger RNA biogenesis [BR:hai03019]
    109393048 (ACTG1)
   03036 Chromosome and associated proteins [BR:hai03036]
    109393048 (ACTG1)
   03029 Mitochondrial biogenesis [BR:hai03029]
    109393048 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hai04812]
    109393048 (ACTG1)
   04147 Exosome [BR:hai04147]
    109393048 (ACTG1)
Transcription machinery [BR:hai03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     109393048 (ACTG1)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     109393048 (ACTG1)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     109393048 (ACTG1)
    NuA4 complex
     109393048 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    109393048 (ACTG1)
   PBAF complex
    109393048 (ACTG1)
   SWR1 complex
    109393048 (ACTG1)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    109393048 (ACTG1)
Cytoskeleton proteins [BR:hai04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     109393048 (ACTG1)
Exosome [BR:hai04147]
 Exosomal proteins
  Proteins found in most exosomes
   109393048 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 109393048
NCBI-ProteinID: XP_019517489
LinkDB
Position
Un
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagaaatcgctgcgctcgtcatcgacaatggctccggcatgtgcaaggctggc
tttgctggcgatgacgccccccgggccgtgttcccgtccatcgtggggcgcccccgacac
cagggcgtcatggtgggcatggggcagaaggacagctacgtgggcgacgaggcccagagc
aagcgcggcatcctgaccctcaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggccccagaggag
caccccgtgctgctgacggaggcccccctgaaccccaaggccaaccgcgagaagatgact
cagatcatgttcgagaccttcaacaccccagccatgtacgtggccatccaggccgtgctg
tccctgtatgcctctggccgcaccactggtattgttatggactctggggatggggtcacc
cacactgtgcccatctacgaggggtacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcacggagcgtggctacagcttc
accaccacggccgagcgggaaatcgtgcgtgacatcaaggagaagctctgctatgtcgcc
ctggactttgagcaggagatggccaccgccgcgtcgtcgtcctccttggagaagagctac
gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgccccgaggcg
ctcttccagccctccttcctgggtatggagtcctgcggcatccacgagaccacattcaac
tccatcatgaagtgtgacgtcgacatccggaaggacctgtacgccaacaccgtgctgtct
ggtgggaccaccatgtaccccggcatcgccgacaggatgcagaaggagatcacggccctg
gcccccagcacgatgaagatcaagatcattgccccgccagagcgcaagtactcggtgtgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtcgggcccctccatcgtccaccgcaagtgcttctag

DBGET integrated database retrieval system