KEGG   Hipposideros armiger (great roundleaf bat): 109380275Help
Entry
109380275         CDS       T04661                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04614  Renin-angiotensin system
hai04924  Renin secretion
hai05142  Chagas disease (American trypanosomiasis)
hai05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hai00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    109380275
   04614 Renin-angiotensin system
    109380275
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    109380275
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    109380275
Enzymes [BR:hai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109380275
Peptidases [BR:hai01002]
 Metallo Peptidases
  Family M2
   109380275
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109380275
CD molecules [BR:hai04090]
 Proteins
  109380275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 CopD DUF4131
Motif
Other DBs
NCBI-GeneID: 109380275
NCBI-ProteinID: XP_019493222
LinkDB All DBs
Position
Un
AA seq 618 aa AA seqDB search
MKTTYNMGQVCLNEGPCMPLEPDLKDIMATSRDQKELLWAWQGWRDAVGRLLRGTFEQYV
QLSNKAARLNGYRDMGALWRAKYESDKLEKDLEQLFQELQPLYLNLHAYVRRALYRYYGP
EVIDVKGPIPAHLLGNMWAQSWVKILDLVLPFPKKPPEDITKIMRSQHWNPEKMFVEAEK
FITSLGLLSTPPDFWENSMMERPTDGREVECHASAWDFYNSKDFRIKKCTEVTTEDLLSI
FHQMGHIQYFMQYKNLPVIFRAGPNPAFEEAVGSVITLSAFSHKHLLNRGLLSRQHQDSE
EEVNFLMGIALDKIAFIPFAYLIDLYRWKVFDGTIQKDNYNLEWWNLRLKYQGLCPPIPR
TEDDFDPGAKFHISASVSYTRYFLSLVLQFQFQEALCKASGHVGPLHRCDIYNSKTAGKL
LEDVLKQGASKPWPEILQNITGKTKMSAEALKTYFKPLMNWLVTENVRQGEILGWPDFSC
SFEEKETDKVKFLSLKLDPDQAKLGQWVLLALSFVMFLVALLLACRLYSLEKQSLAQDTS
AQGTSRQDTSSQDTSLKTPPNSYFLGIAMKPSQVAKRQWILLGFCLILMLCSIGLIIRIF
TQHHRKPPWMSAEWWSWD
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaacatacaacatgggccaggtgtgcctgaatgaggggccctgcatgcccctg
gagcctgacctcaaagatatcatggccacctcccgggaccagaaggagctgctgtgggcc
tggcagggctggcgggacgctgtgggtcgcctgctccgtggcaccttcgagcagtatgtg
cagctcagcaacaaggctgcgaggctcaatggttacagagacatgggggccctgtggcgg
gccaaatatgaatctgacaagctggagaaggacctggagcagctcttccaggagctgcag
ccgctctacctgaacctgcacgcctacgtgcgccgggccctgtatcgctactatggaccc
gaggtcatcgatgtgaaggggcccatccctgcccacctcctggggaacatgtgggctcag
tcctgggtcaaaatcttagacctggtcctacccttcccaaagaagccccctgaggacatc
acaaagatcatgcgaagccagcactggaaccccgagaaaatgttcgtagaggctgaaaaa
ttcatcacctccctggggctgctttccacccctcctgatttctgggaaaattcgatgatg
gaaagaccaaccgatggccgggaagtggagtgccacgcctccgcctgggacttctacaac
agcaaggacttcaggataaagaagtgcaccgaggtgaccacagaagacctgctctccatc
ttccaccagatgggccatatccagtacttcatgcagtataagaacctccccgtgatcttc
cgtgcaggccccaacccagcctttgaagaggctgtggggtcagtgatcaccctctcggcc
ttttcccacaagcacctgctcaacagaggcctgctcagccgtcagcatcaggactcagag
gaggaggtcaatttcctgatgggtattgccctggacaagatcgcattcatccccttcgcc
tatctgattgacttgtatcgctggaaggtctttgacggcaccatccagaaggataactac
aacctggagtggtggaacctcaggttgaagtaccagggcctgtgccctcccatccctcgg
acagaagatgactttgatccaggtgccaagttccacatctctgccagtgtgtcctacaca
cggtacttcctaagcctagtgctccagttccagttccaagaagcgctgtgcaaagcctca
ggccacgtgggtcctctgcaccgctgtgacatctacaactcgaagacagccggcaagctc
ctggaggacgtcctaaagcagggtgccagcaaaccctggccagagatcctgcagaatata
accgggaagaccaagatgtctgcagaggcccttaagacctacttcaagcccctgatgaac
tggctggtcaccgagaatgtgcgccagggggagatcctgggctggccagacttcagctgt
tcctttgaagagaaagaaacagacaaggtgaagttcctgagcctgaaactggaccctgat
caggccaaacttgggcaatgggtgttgctggccctgagctttgtcatgttcctggtggct
ctactgctggcctgcaggctgtactccctggaaaaacaatcactggctcaggacaccagt
gcacagggcaccagtagacaggacaccagttcacaggacaccagtctcaagacaccaccc
aacagctacttcctgggcatagccatgaagcccagccaggttgccaaaagacagtggatt
ctgctgggcttctgcctcatcctgatgctgtgctcaatcggcctgatcataagaattttc
acacagcaccacaggaagcctccgtggatgagcgctgaatggtggagctgggactag

DBGET integrated database retrieval system