KEGG   Hipposideros armiger (great roundleaf bat): 109380289
Entry
109380289         CDS       T04661                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04066  HIF-1 signaling pathway
hai04070  Phosphatidylinositol signaling system
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04261  Adrenergic signaling in cardiomyocytes
hai04270  Vascular smooth muscle contraction
hai04310  Wnt signaling pathway
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04510  Focal adhesion
hai04540  Gap junction
hai04650  Natural killer cell mediated cytotoxicity
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04670  Leukocyte transendothelial migration
hai04713  Circadian entrainment
hai04720  Long-term potentiation
hai04723  Retrograde endocannabinoid signaling
hai04724  Glutamatergic synapse
hai04725  Cholinergic synapse
hai04726  Serotonergic synapse
hai04727  GABAergic synapse
hai04728  Dopaminergic synapse
hai04730  Long-term depression
hai04750  Inflammatory mediator regulation of TRP channels
hai04911  Insulin secretion
hai04912  GnRH signaling pathway
hai04916  Melanogenesis
hai04918  Thyroid hormone synthesis
hai04919  Thyroid hormone signaling pathway
hai04921  Oxytocin signaling pathway
hai04925  Aldosterone synthesis and secretion
hai04926  Relaxin signaling pathway
hai04928  Parathyroid hormone synthesis, secretion and action
hai04929  GnRH secretion
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04960  Aldosterone-regulated sodium reabsorption
hai04961  Endocrine and other factor-regulated calcium reabsorption
hai04970  Salivary secretion
hai04971  Gastric acid secretion
hai04972  Pancreatic secretion
hai05017  Spinocerebellar ataxia
hai05022  Pathways of neurodegeneration - multiple diseases
hai05031  Amphetamine addiction
hai05032  Morphine addiction
hai05143  African trypanosomiasis
hai05146  Amoebiasis
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05214  Glioma
hai05223  Non-small cell lung cancer
hai05225  Hepatocellular carcinoma
hai05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109380289 (PRKCA)
   04012 ErbB signaling pathway
    109380289 (PRKCA)
   04014 Ras signaling pathway
    109380289 (PRKCA)
   04015 Rap1 signaling pathway
    109380289 (PRKCA)
   04310 Wnt signaling pathway
    109380289 (PRKCA)
   04370 VEGF signaling pathway
    109380289 (PRKCA)
   04066 HIF-1 signaling pathway
    109380289 (PRKCA)
   04020 Calcium signaling pathway
    109380289 (PRKCA)
   04070 Phosphatidylinositol signaling system
    109380289 (PRKCA)
   04072 Phospholipase D signaling pathway
    109380289 (PRKCA)
   04071 Sphingolipid signaling pathway
    109380289 (PRKCA)
   04151 PI3K-Akt signaling pathway
    109380289 (PRKCA)
   04150 mTOR signaling pathway
    109380289 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109380289 (PRKCA)
   04540 Gap junction
    109380289 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109380289 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    109380289 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    109380289 (PRKCA)
   04670 Leukocyte transendothelial migration
    109380289 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    109380289 (PRKCA)
   04929 GnRH secretion
    109380289 (PRKCA)
   04912 GnRH signaling pathway
    109380289 (PRKCA)
   04921 Oxytocin signaling pathway
    109380289 (PRKCA)
   04926 Relaxin signaling pathway
    109380289 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    109380289 (PRKCA)
   04918 Thyroid hormone synthesis
    109380289 (PRKCA)
   04919 Thyroid hormone signaling pathway
    109380289 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    109380289 (PRKCA)
   04916 Melanogenesis
    109380289 (PRKCA)
   04925 Aldosterone synthesis and secretion
    109380289 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109380289 (PRKCA)
   04270 Vascular smooth muscle contraction
    109380289 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    109380289 (PRKCA)
   04971 Gastric acid secretion
    109380289 (PRKCA)
   04972 Pancreatic secretion
    109380289 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109380289 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109380289 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    109380289 (PRKCA)
   04727 GABAergic synapse
    109380289 (PRKCA)
   04725 Cholinergic synapse
    109380289 (PRKCA)
   04728 Dopaminergic synapse
    109380289 (PRKCA)
   04726 Serotonergic synapse
    109380289 (PRKCA)
   04720 Long-term potentiation
    109380289 (PRKCA)
   04730 Long-term depression
    109380289 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    109380289 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109380289 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    109380289 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109380289 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109380289 (PRKCA)
   05206 MicroRNAs in cancer
    109380289 (PRKCA)
   05205 Proteoglycans in cancer
    109380289 (PRKCA)
   05231 Choline metabolism in cancer
    109380289 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109380289 (PRKCA)
   05214 Glioma
    109380289 (PRKCA)
   05223 Non-small cell lung cancer
    109380289 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    109380289 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    109380289 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    109380289 (PRKCA)
   05032 Morphine addiction
    109380289 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109380289 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109380289 (PRKCA)
   05164 Influenza A
    109380289 (PRKCA)
   05161 Hepatitis B
    109380289 (PRKCA)
   05163 Human cytomegalovirus infection
    109380289 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109380289 (PRKCA)
   05143 African trypanosomiasis
    109380289 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109380289 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109380289 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109380289 (PRKCA)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     109380289 (PRKCA)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   109380289 (PRKCA)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    109380289 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 109380289
NCBI-ProteinID: XP_019493253
LinkDB
Position
Un
AA seq 671 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEWRQLSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGT
EELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVN
GGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIAD
FGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGE
DEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRID
WEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNP
QFVHPILQSAV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggctaacgattccacggcgtctcaggacgtggccaaccgcttc
gcgcgcaaaggggcgctgagacagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcagataagggacccgacactgatgatcccaggagc
aagcacaagtttaaaatccacacttatggaagccccaccttctgtgatcattgtgggtca
ttgctatacggacttattcatcaagggatgaaatgtgacacctgtgatatgaacgtgcac
aagcagtgtgtgatcaacgtccccagcctctgcgggatggaccacaccgagaagaggggg
cgcatctacctgaaggctgaggtcaccgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatcccaatggactctcagatccttacgtgaagctgaaactc
attcctgatcccaagaatgaaagcaaacaaaaaaccaaaaccatccgctccacactaaat
ccccagtggaacgagtcctttacattcaaattaaaaccttccgataaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaacgacttcatgggatccctgtcc
tttggcgtttcagagctgatgaagatgccagccagtggctggtacaagctgcttaaccaa
gaagaaggtgagtactacaacgtacccattccagaaggggatgaagaaggaaacatggaa
ctcaggcagaaattcgagaaagccaagcttggccccgctggtaacaaagtcatcagtcct
tcagagtggaggcaactttccaacaacctggacagagtgaaactcaccgacttcaatttc
ctcatggtgctggggaaggggagttttggaaaggtgatgctcgctgacaggaagggaaca
gaagaactgtacgccatcaaaatcctcaagaaggacgtggtgattcaggatgacgacgtg
gagtgcaccatggtggagaagcgcgtcctggccctgctcgacaagcccccgttcctgacg
cagctgcactcctgcttccagacggtggatcggctgtacttcgtcatggaatacgtcaac
ggtggggacctcatgtaccacattcagcaagtggggaaatttaaggagccacaagcagta
ttctatgcggcagagatttccattggattgttctttcttcataaaagaggaatcatttat
agggatctgaagctcgataatgtcatgctggattcggaaggacacatcaagatcgccgac
tttggcatgtgcaaggagcacatgatggatggggtcacgacccggaccttctgtgggact
ccagattacattgccccagagatcatcgcttatcagccgtatgggaaatccgtggactgg
tgggcttacggcgtcctattatatgaaatgctggctgggcagcccccgtttgatggcgaa
gatgaagacgaactatttcagtccataatggagcacaacgtttcttatccaaaatccttg
tcgaaggaggccgtttccatctgcaaaggactgatgaccaaacatccaggcaaaaggctg
ggctgtgggccggagggagagagggacgtgcgagaacacgccttcttccggaggatcgac
tgggagaaactggagaacagggagatccagccgccgttcaagcccaaagtgtgcggcaaa
ggagcggaaaactttgacaagttcttcacacgagggcaacccgtcttaacccctcccgat
cagctggtcattgctaacatagaccagtctgactttgaagggttctcgtatgtaaacccc
cagtttgtgcaccccattttacagagcgcagtatga

DBGET integrated database retrieval system